KEGG   Homo sapiens (human): 481Help
Entry
481               CDS       T01001                                 

Gene name
ATP1B1, ATP1B
Definition
ATPase, Na+/K+ transporting, beta 1 polypeptide
Orthology
K01540  
sodium/potassium-transporting ATPase subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Drug target
Acetyldigitoxin: 
Acetyldigoxin: 
Digitoxin: 
Digoxin: 
Lanatoside C: 
Deslanoside: 
Metildigoxin: 
Gitoformate: 
Proscillaridin: 
G-strophanthin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    481 (ATP1B1)
   04022 cGMP - PKG signaling pathway
    481 (ATP1B1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    481 (ATP1B1)
   04918 Thyroid hormone synthesis
    481 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    481 (ATP1B1)
  Circulatory system
   04260 Cardiac muscle contraction
    481 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    481 (ATP1B1)
  Digestive system
   04970 Salivary secretion
    481 (ATP1B1)
   04971 Gastric acid secretion
    481 (ATP1B1)
   04972 Pancreatic secretion
    481 (ATP1B1)
   04976 Bile secretion
    481 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    481 (ATP1B1)
   04974 Protein digestion and absorption
    481 (ATP1B1)
   04978 Mineral absorption
    481 (ATP1B1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    481 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    481 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    481 (ATP1B1)
Cellular antigens [BR:hsa04090]
 Proteins
  481 (ATP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q24
AA seq 303 aa AA seqDB search
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKL
NRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgggaaagccaaggaggagggcagctggaagaaattcatctggaactcagag
aagaaggagtttctgggcaggaccggtggcagttggtttaagatccttctattctacgta
atattttatggctgcctggctggcatcttcatcggaaccatccaagtgatgctgctcacc
atcagtgaatttaagcccacatatcaggaccgagtggccccgccaggattaacacagatt
cctcagatccagaagactgaaatttcctttcgtcctaatgatcccaagagctatgaggca
tatgtactgaacatagttaggttcctggaaaagtacaaagattcagcccagagggatgac
atgatttttgaagattgtggcgatgtgcccagtgaaccgaaagaacgaggagactttaat
catgaacgaggagagcgaaaggtctgcagattcaagcttgaatggctgggaaattgctct
ggattaaatgatgaaacttatggctacaaagagggcaaaccgtgcattattataaagctc
aaccgagttctaggcttcaaacctaagcctcccaagaatgagtccttggagacttaccca
gtgatgaagtataacccaaatgtccttcccgttcagtgcactggcaagcgagatgaagat
aaggataaagttggaaatgtggagtattttggactgggcaactcccctggttttcctctg
cagtattatccgtactatggcaaactcctgcagcccaaatacctgcagcccctgctggcc
gtacagttcaccaatcttaccatggacactgaaattcgcatagagtgtaaggcgtacggt
gagaacattgggtacagtgagaaagaccgttttcagggacgttttgatgtaaaaattgaa
gttaagagctga

DBGET integrated database retrieval system