KEGG   Homo sapiens (human): 482Help
Entry
482               CDS       T01001                                 

Gene name
ATP1B2, AMOG
Definition
ATPase, Na+/K+ transporting, beta 2 polypeptide (EC:3.6.3.9)
Orthology
K01540  
sodium/potassium-transporting ATPase subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Drug target
Acetyldigitoxin: 
Acetyldigoxin: 
Digitoxin: 
Digoxin: 
Lanatoside C: 
Deslanoside: 
Metildigoxin: 
Gitoformate: 
Proscillaridin: 
G-strophanthin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    482 (ATP1B2)
   04022 cGMP - PKG signaling pathway
    482 (ATP1B2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    482 (ATP1B2)
   04918 Thyroid hormone synthesis
    482 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    482 (ATP1B2)
  Circulatory system
   04260 Cardiac muscle contraction
    482 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    482 (ATP1B2)
  Digestive system
   04970 Salivary secretion
    482 (ATP1B2)
   04971 Gastric acid secretion
    482 (ATP1B2)
   04972 Pancreatic secretion
    482 (ATP1B2)
   04976 Bile secretion
    482 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    482 (ATP1B2)
   04974 Protein digestion and absorption
    482 (ATP1B2)
   04978 Mineral absorption
    482 (ATP1B2)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    482 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    482 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    482 (ATP1B2)
Cellular antigens [BR:hsa04090]
 Proteins
  482 (ATP1B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 290 aa AA seqDB search
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgaggacgcaccagtttatgggccgcaccgggaccagctgggcctttatc
ctcctcttctacctcgttttttatgggttcctcaccgccatgttcaccctcaccatgtgg
gtgatgctgcagactgtctccgaccatacccccaagtaccaggaccgactggccacaccg
ggcttgatgattcgccccaagactgagaaccttgatgtcattgtcaatgtcagtgacact
gaaagctgggaccagcatgttcagaagctcaacaagttcttggagccttacaacgactct
atccaagcccaaaagaatgatgtctgccgccctgggcgctattacgaacagccagataat
ggagtcctcaactaccccaaacgtgcctgccaattcaaccggacccagctgggcaactgc
tccggcattggggactccacccactatggttacagcactgggcagccctgtgtcttcatc
aagatgaaccgggtcatcaacttctatgcaggagcaaaccagagcatgaatgttacctgt
gctgggaagcgagatgaagatgctgagaatctcggcaacttcgtcatgttccccgccaac
ggcaacatcgacctcatgtacttcccctactatggcaaaaagttccacgtgaactacaca
cagcccctggtggctgtgaagttcctgaatgtgacccccaacgtggaggtgaatgtagaa
tgtcgcatcaacgccgccaacatcgccacagacgatgagcgagacaagttcgccggccgc
gtggccttcaaactccgcatcaacaaaacctga

DBGET integrated database retrieval system