KEGG   Homo sapiens (human): 4842Help
Entry
4842              CDS       T01001                                 

Gene name
NOS1, IHPS1, N-NOS, NC-NOS, NOS, bNOS, nNOS
Definition
nitric oxide synthase 1 (neuronal) (EC:1.14.13.39)
Orthology
K13240  
nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
Phagosome
Circadian entrainment
Long-term depression
Salivary secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Drug target
Other: 
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.22
AA seq 1434 aa AA seqDB search
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE
PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE
DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcacatgttcggtgttcagcaaatccagcccaatgtcatttctgttcgtctc
ttcaagcgcaaagttgggggcctgggatttctggtgaaggagcgggtcagtaagccgccc
gtgatcatctctgacctgattcgtgggggcgccgcagagcagagtggcctcatccaggcc
ggagacatcattcttgcggtcaacggccggcccttggtggacctgagctatgacagcgcc
ctggaggtactcagaggcattgcctctgagacccacgtggtcctcattctgaggggccct
gaaggtttcaccacgcacctggagaccacctttacaggtgatgggacccccaagaccatc
cgggtgacacagcccctgggtccccccaccaaagccgtggatctgtcccaccagccaccg
gccggcaaagaacagcccctggcagtggatggggcctcgggtcccgggaatgggcctcag
catgcctacgatgatgggcaggaggctggctcactcccccatgccaacggcctggccccc
aggcccccaggccaggaccccgcgaagaaagcaaccagagtcagcctccaaggcagaggg
gagaacaatgaactgctcaaggagatagagcctgtgctgagccttctcaccagtgggagc
agaggggtcaagggaggggcacctgccaaggcagagatgaaagatatgggaatccaggtg
gacagagatttggacggcaagtcacacaaacctctgcccctcggcgtggagaacgaccga
gtcttcaatgacctatgggggaagggcaatgtgcctgtcgtcctcaacaacccatattca
gagaaggagcagccccccacctcaggaaaacagtcccccacaaagaatggcagcccctcc
aagtgtccacgcttcctcaaggtcaagaactgggagactgaggtggttctcactgacacc
ctccaccttaagagcacattggaaacgggatgcactgagtacatctgcatgggctccatc
atgcatccttctcagcatgcaaggaggcctgaagacgtccgcacaaaaggacagctcttc
cctctcgccaaagagtttattgatcaatactattcatcaattaaaagatttggctccaaa
gcccacatggaaaggctggaagaggtgaacaaagagatcgacaccactagcacttaccag
ctcaaggacacagagctcatctatggggccaagcacgcctggcggaatgcctcgcgctgt
gtgggcaggatccagtggtccaagctgcaggtattcgatgcccgtgactgcaccacggcc
cacgggatgttcaactacatctgtaaccatgtcaagtatgccaccaacaaagggaacctc
aggtctgccatcaccatattcccccagaggacagacggcaagcacgacttccgagtctgg
aactcccagctcatccgctacgctggctacaagcagcctgacggctccaccctgggggac
ccagccaatgtgcagttcacagagatatgcatacagcagggctggaaaccgcctagaggc
cgcttcgatgtcctgccgctcctgcttcaggccaacggcaatgaccctgagctcttccag
attcctccagagctggtgttggaagttcccatcaggcaccccaagtttgagtggttcaag
gacctggggctgaagtggtacggcctccccgccgtgtccaacatgctcctagagattggc
ggcctggagttcagcgcctgtcccttcagtggctggtacatgggcacagagattggtgtc
cgcgactactgtgacaactcccgctacaatatcctggaggaagtggccaagaagatgaac
ttagacatgaggaagacgtcctccctgtggaaggaccaggcgctggtggagatcaatatc
gcggttctctatagcttccagagtgacaaagtgaccattgttgaccatcactccgccacc
gagtccttcattaagcacatggagaatgagtaccgctgccgggggggctgccctgccgac
tgggtgtggatcgtgccccccatgtccggaagcatcacccctgtgttccaccaggagatg
ctcaactaccggctcaccccctccttcgaataccagcctgatccctggaacacgcatgtc
tggaaaggcaccaacgggacccccacaaagcggcgagccattggcttcaagaagctagca
gaagctgtcaagttctcggccaagctgatggggcaggctatggccaagagggtgaaagcg
accatcctctatgccacagagacaggcaaatcgcaagcttatgccaagaccttgtgtgag
atcttcaaacacgcctttgatgccaaggtgatgtccatggaagaatatgacattgtgcac
ctggaacatgaaactctggtccttgtggtcaccagcacctttggcaatggagatccccct
gagaatggggagaaattcggctgtgctttgatggaaatgaggcaccccaactctgtgcag
gaagaaaggaagagctacaaggtccgattcaacagcgtctcctcctactctgactcccaa
aaatcatcaggcgatgggcccgacctcagagacaactttgagagtgctggacccctggcc
aatgtgaggttctcagtttttggcctcggctcacgagcataccctcacttttgcgccttc
ggacacgctgtggacaccctcctggaagaactgggaggggagaggatcctgaagatgagg
gaaggggatgagctctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgtgatgtcttctgtgtgggagatgatgtcaacattgaaaaggccaacaat
tccctcatcagcaatgatcgcagctggaagagaaacaagttccgcctcacctttgtggcc
gaagctccagaactcacacaaggtctatccaatgtccacaaaaagcgagtctcagctgcc
cggctccttagccgtcaaaacctccagagccctaaatccagtcggtcaactatcttcgtg
cgtctccacaccaacgggagccaggagctgcagtaccagcctggggaccacctgggtgtc
ttccctggcaaccacgaggacctcgtgaatgccctgatcgagcggctggaggacgcgccg
cctgtcaaccagatggtgaaagtggaactgctggaggagcggaacacggctttaggtgtc
atcagtaactggacagacgagctccgcctcccgccctgcaccatcttccaggccttcaag
tactacctggacatcaccacgccaccaacgcctctgcagctgcagcagtttgcctcccta
gctaccagcgagaaggagaagcagcgtctgctggtcctcagcaagggtttgcaggagtac
gaggaatggaaatggggcaagaaccccaccatcgtggaggtgctggaggagttcccatct
atccagatgccggccaccctgctcctgacccagctgtccctgctgcagccccgctactat
tccatcagctcctccccagacatgtaccctgatgaagtgcacctcactgtggccatcgtt
tcctaccgcactcgagatggagaaggaccaattcaccacggcgtatgctcctcctggctc
aaccggatacaggctgacgaactggtcccctgtttcgtgagaggagcacccagcttccac
ctgccccggaacccccaagtcccctgcatcctcgttggaccaggcaccggcattgcccct
ttccgaagcttctggcaacagcggcaatttgatatccaacacaaaggaatgaacccctgc
cccatggtcctggtcttcgggtgccggcaatccaagatagatcatatctacagggaagag
accctgcaggccaagaacaagggggtcttcagagagctgtacacggcttactcccgggag
ccagacaaaccaaagaagtacgtgcaggacatcctgcaggagcagctggcggagtctgtg
taccgagccctgaaggagcaagggggccacatatacgtctgtggggacgtcaccatggct
gctgatgtcctcaaagccatccagcgcatcatgacccagcaggggaagctctcggcagag
gacgccggcgtattcatcagccggatgagggatgacaaccgataccatgaggatattttt
ggagtcaccctgcgaacgtacgaagtgaccaaccgccttagatctgagtccattgccttc
attgaagagagcaaaaaagacaccgatgaggttttcagctcctaa

DBGET integrated database retrieval system