KEGG   Homo sapiens (human): 4846Help
Entry
4846              CDS       T01001                                 

Gene name
NOS3, ECNOS, eNOS
Definition
nitric oxide synthase 3 (endothelial cell) (EC:1.14.13.39)
Orthology
K13242  
nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Estrogen signaling pathway
Oxytocin signaling pathway
Drug target
Other: 
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 1203 aa AA seqDB search
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggagcctgggccaccctgcggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagccaccccggcccctgagcccagccgg
gccccagcatccctactcccaccagcgccagaacacagccccccgagctccccgctaacc
cagcccccagaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcacc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctcccccggccccccggcccct
gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccattaagagg
agcggctcccaggcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggagagcgagctggtgttcggggctaagcaggcctggcgcaac
gctccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctacgcgggctaccggcagcaggatggctct
gtgcggggggacccagccaacgtggagatcaccgagctctgcattcagcacggctggacc
ccaggaaacggtcgcttcgacgtgctgcccctgctgctgcaggccccagatgatccccca
gaactcttccttctgccccccgagctggtccttgaggtgcccctggagcaccccacgctg
gagtggtttgcagccctgggcctgcgctggtacgccctcccggcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggct
gtctgcatggacctggatacccggaccacctcgtccctgtggaaagacaaggcagcagtg
gaaatcaacgtggccgtgctgcacagttaccagctagccaaagtcaccatcgtggaccac
cacgccgccacggcctctttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcagactgggcctggatcgtgccccccatctcgggcagcctcactcctgttttc
catcaggagatggtcaactatttcctgtccccggccttccgctaccagccagacccctgg
aaggggagtgccgccaagggcaccggcatcaccaggaagaagacctttaaagaagtggcc
aacgccgtgaagatctccgcctcgctcatgggcacggtgatggcgaagcgagtgaaggcg
acaatcctgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga
ctcttccggaaggcttttgatccccgggtcctgtgtatggatgagtatgacgtggtgtcc
ctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatcccccg
gagaatggagagagctttgcagctgccctgatggagatgtccggcccctacaacagctcc
cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcaccctcaggttctgtgtgttcgggctcggctcccgggcatacccccacttc
tgcgcctttgctcgtgccgtggacacacggctggaggaactgggcggggagcggctgctg
cagctgggccagggcgacgagctgtgcggccaggaggaggccttccgaggctgggcccag
gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgccgcc
cgagacatcttcagccccaaacggagctggaagcgccagaggtaccggctgagcgcccag
gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag
gctacaatccgctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacaccggaggccaggaggggctgcagtaccagccgggggaccacataggt
gtctgcccgcccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
ccggcgcccactgagcccgtggcagtagagcagctggagaagggcagccctggtggccct
ccccccggctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccacccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagggaacagcaggagctggaggccctcagccaggatccccgacgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg
gtggcgctgcctgccccactgctcctcacccagctgcctctgctccagccccggtactac
tcagtcagctcggcacccagcacccacccaggagagatccacctcactgtagctgtgctg
gcatacaggactcaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccagctcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacccgatcccagcttgccctgcatcctggtgggtccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgttcggctgccgatgctcccaacttgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgaggacggagctggctgcggaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgttaccatggca
accaacgtcctgcagaccgtgcagcgcatcctggcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg
caggagcgtcagttgcggggcgcagtgccctgggcgttcgaccctcccggctcagacacc
aacagcccctga

DBGET integrated database retrieval system