KEGG   Homo sapiens (human): 4850Help
Entry
4850              CDS       T01001                                 

Gene name
CNOT4, CLONE243, NOT4, NOT4H
Definition
CCR4-NOT transcription complex, subunit 4
Orthology
K10643  
CCR4-NOT transcription complex subunit 4 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    4850 (CNOT4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     4850 (CNOT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q33
AA seq 572 aa AA seqDB search
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPP
PGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSD
WPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL
SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHR
AVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAG
EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcagtcctgatgcgaaggaagaccctgtggagtgccctctttgcatggagccc
ttggagatagatgatatcaactttttcccttgcacctgtggctaccagatttgccgattt
tgttggcatcgaattcgcactgatgaaaatgggctttgtcctgcatgtagaaagccatat
ccagaagacccagcagtttataaaccactctcccaggaagagctgcaaaggataaagaat
gagaaaaaacagaaacaaaatgagagaaaacagaaaatatcagaaaatcgcaaacatttg
gctagtgtacgtgtcgtacaaaaaaacctcgtctttgttgtaggtttatctcagcgccta
gcagacccagaggttttaaaacgaccagaatattttgggaagtttggtaaaatacataaa
gttgtcatcaataatagcacatcatatgcaggctcacagggtccaagtgccagtgcttat
gtaacctatatccggtcagaagacgctctcagagccatacagtgtgtcaacaatgtggta
gtagatggcagaacacttaaggcatctctaggtacaacaaaatactgcagttacttctta
aagaatatgcagtgtccaaaacctgactgcatgtatcttcatgaattgggggatgaggcg
gccagcttcacaaaagaggaaatgcaggcgggtaaacaccaagaatatgaacagaagcta
cttcaagaattatataaattaaatcccaattttcttcagctatctacgggttcagttgat
aaaaataagaacaaagtgacaccactgcagagccccattgacaaaccttcagattctctc
agtatagggaacggtgataattcccagcagatatctaacagtgatacgccttcaccacca
cctggtttgtcaaaatccaatccagtcatccccatcagttcatccaatcacagtgcacgg
tccccttttgaaggggcagtaacagagtcacagtcgttattctcagacaattttcgccat
cccaaccctatcccaagtgggcttcctcctttccccagctccccacagacatccagtgac
tggcctacagcaccagaaccacagagcctcttcacatcagaaacaatcccagtatcatcc
tctacagactggcaagcagcttttggctttggttcttctaaacaaccagaggatgacttg
ggttttgatcccttcgatgtcactcgaaaagccttagcagacctgattgagaaggaactg
tccgttcaagaccaaccttccctttcgcccacatctcttcagaactcctcttcacacact
acaaccgccaaaggtccaggctctggattcctgcatcctgctgcagctacaaatgccaat
tctctcaatagtaccttttcagtcttgccccagaggttccctcaatttcagcagcaccga
gcggtttataattcattcagttttccaggccaggcagcccgctatccttggatggccttt
ccacgcaatagcatcatgcacttgaaccacacagcaaaccccacctcaaatagtaatttc
ttggacttgaatctcccgccacagcacaacacaggtctgggagggatccctgtagcaggg
gaagaagaggtgaaggtttcgaccatgccactgtcaacctcttcccattcattacaacaa
ggacagcagcctacaagtctccacactactgtggcctga

DBGET integrated database retrieval system