KEGG   Homo sapiens (human): 4850Help
Entry
4850              CDS       T01001                                 

Gene name
CNOT4, CLONE243, NOT4, NOT4H
Definition
(RefSeq) CCR4-NOT transcription complex subunit 4
  KO
K10643  
CCR4-NOT transcription complex subunit 4 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    4850 (CNOT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4850 (CNOT4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4850 (CNOT4)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4850 (CNOT4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4850 (CNOT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q33
AA seq 575 aa AA seqDB search
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTP
SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQT
SSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQ
QHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIP
VAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcagtcctgatgcgaaggaagaccctgtggagtgccctctttgcatggagccc
ttggagatagatgatatcaactttttcccttgcacctgtggctaccagatttgccgattt
tgttggcatcgaattcgcactgatgaaaatgggctttgtcctgcatgtagaaagccatat
ccagaagacccagcagtttataaaccactctcccaggaagagctgcaaaggataaagaat
gagaaaaaacagaaacaaaatgagagaaaacagaaaatatcagaaaatcgcaaacatttg
gctagtgtacgtgtcgtacaaaaaaacctcgtctttgttgtaggtttatctcagcgccta
gcagacccagaggttttaaaacgaccagaatattttgggaagtttggtaaaatacataaa
gttgtcatcaataatagcacatcatatgcaggctcacagggtccaagtgccagtgcttat
gtaacctatatccggtcagaagacgctctcagagccatacagtgtgtcaacaatgtggta
gtagatggcagaacacttaaggcatctctaggtacaacaaaatactgcagttacttctta
aagaatatgcagtgtccaaaacctgactgcatgtatcttcatgaattgggggatgaggcg
gccagcttcacaaaagaggaaatgcaggcgggtaaacaccaagaatatgaacagaagcta
cttcaagaattatataaattaaatcccaattttcttcagctatctacgggttcagttgat
aaaaataagaacaaagtgacaccactgcagaggtacgatacccccattgacaaaccttca
gattctctcagtatagggaacggtgataattcccagcagatatctaacagtgatacgcct
tcaccaccacctggtttgtcaaaatccaatccagtcatccccatcagttcatccaatcac
agtgcacggtccccttttgaaggggcagtaacagagtcacagtcgttattctcagacaat
tttcgccatcccaaccctatcccaagtgggcttcctcctttccccagctccccacagaca
tccagtgactggcctacagcaccagaaccacagagcctcttcacatcagaaacaatccca
gtatcatcctctacagactggcaagcagcttttggctttggttcttctaaacaaccagag
gatgacttgggttttgatcccttcgatgtcactcgaaaagccttagcagacctgattgag
aaggaactgtccgttcaagaccaaccttccctttcgcccacatctcttcagaactcctct
tcacacactacaaccgccaaaggtccaggctctggattcctgcatcctgctgcagctaca
aatgccaattctctcaatagtaccttttcagtcttgccccagaggttccctcaatttcag
cagcaccgagcggtttataattcattcagttttccaggccaggcagcccgctatccttgg
atggcctttccacgcaatagcatcatgcacttgaaccacacagcaaaccccacctcaaat
agtaatttcttggacttgaatctcccgccacagcacaacacaggtctgggagggatccct
gtagcaggggaagaagaggtgaaggtttcgaccatgccactgtcaacctcttcccattca
ttacaacaaggacagcagcctacaagtctccacactactgtggcctga

DBGET integrated database retrieval system