KEGG   Homo sapiens (human): 4854Help
Entry
4854              CDS       T01001                                 

Gene name
NOTCH3, CADASIL, CASIL, IMF2
Definition
notch 3
Orthology
K02599  
Notch
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Notch signaling pathway
Thyroid hormone signaling pathway
MicroRNAs in cancer
Disease
H00536  
Cerebral autosomal dominant arteriopathy with subcortical infarcts and leucoencephalopathy (CADASIL)
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:hsa04320]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2-p13.1
AA seq 2321 aa AA seqDB search
MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCDRNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
NT seq 6966 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggggcccgtggccgccgccgccgccgtcgcccgatgtcgccgccaccgcca
ccgccacccgtgcgggcgctgcccctgctgctgctgctagcggggccgggggctgcagcc
cccccttgcctggacggaagcccgtgtgcaaatggaggtcgttgcacccagctgccctcc
cgggaggctgcctgcctgtgcccgcctggctgggtgggtgagcggtgtcagctggaggac
ccctgtcactcaggcccctgtgctggccgtggtgtctgccagagttcagtggtggctggc
accgcccgattctcatgccggtgcccccgtggcttccgaggccctgactgctccctgcca
gatccctgcctcagcagcccttgtgcccacggtgcccgctgctcagtggggcccgatgga
cgcttcctctgctcctgcccacctggctaccagggccgcagctgccgaagcgacgtggat
gagtgccgggtgggtgagccctgccgccatggtggcacctgcctcaacacacctggctcc
ttccgctgccagtgtccagctggctacacagggccactatgtgagaaccccgcggtgccc
tgtgcaccctcaccatgccgtaacgggggcacctgcaggcagagtggcgacctcacttac
gactgtgcctgtcttcctgggtttgagggtcagaattgtgaagtgaacgtggacgactgt
ccaggacaccgatgtctcaatggggggacatgcgtggatggcgtcaacacctataactgc
cagtgccctcctgagtggacaggccagttctgcacggaggacgtggatgagtgtcagctg
cagcccaacgcctgccacaatgggggtacctgcttcaacacgctgggtggccacagctgc
gtgtgtgtcaatggctggacaggcgagagctgcagtcagaatatcgatgactgtgccaca
gccgtgtgcttccatggggccacctgccatgaccgcgtggcttctttctactgtgcctgc
cccatgggcaagactggcctcctgtgtcacctggatgacgcctgtgtcagcaacccctgc
cacgaggatgctatctgtgacacaaatccggtgaacggccgggccatttgcacctgtcct
cccggcttcacgggtggggcatgtgaccaggatgtggacgagtgctctatcggcgccaac
ccctgcgagcacttgggcaggtgcgtgaacacgcagggctccttcctgtgccagtgcggt
cgtggctacactggacctcgctgtgagaccgatgtcaacgagtgtctgtcggggccctgc
cgaaaccaggccacgtgcctcgaccgcataggccagttcacctgtatctgtatggcaggc
ttcacaggaacctattgcgaggtggacattgacgagtgtcagagtagcccctgtgtcaac
ggtggggtctgcaaggaccgagtcaatggcttcagctgcacctgcccctcgggcttcagc
ggctccacgtgtcagctggacgtggacgaatgcgccagcacgccctgcaggaatggcgcc
aaatgcgtggaccagcccgatggctacgagtgccgctgtgccgagggctttgagggcacg
ctgtgtgatcgcaacgtggacgactgctcccctgacccatgccaccatggtcgctgcgtg
gatggcatcgccagcttctcatgtgcctgtgctcctggctacacgggcacacgctgcgag
agccaggtggacgaatgccgcagccagccctgccgccatggcggcaaatgcctagacctg
gtggacaagtacctctgccgctgcccttctgggaccacaggtgtgaactgcgaagtgaac
attgacgactgtgccagcaacccctgcacctttggagtctgccgtgatggcatcaaccgc
tacgactgtgtctgccaacctggcttcacagggcccctttgtaacgtggagatcaatgag
tgtgcttccagcccatgcggcgagggaggttcctgtgtggatggggaaaatggcttccgc
tgcctctgcccgcctggctccttgcccccactctgcctccccccgagccatccctgtgcc
catgagccctgcagtcacggcatctgctatgatgcacctggcgggttccgctgtgtgtgt
gagcctggctggagtggcccccgctgcagccagagcctggcccgagacgcctgtgagtcc
cagccgtgcagggccggtgggacatgcagcagcgatggaatgggtttccactgcacctgc
ccgcctggtgtccagggacgtcagtgtgaactcctctccccctgcaccccgaacccctgt
gagcatgggggccgctgcgagtctgcccctggccagctgcctgtctgctcctgcccccag
ggctggcaaggcccacgatgccagcaggatgtggacgagtgtgctggccccgcaccctgt
ggccctcatggtatctgcaccaacctggcagggagtttcagctgcacctgccatggaggg
tacactggcccttcctgcgatcaggacatcaatgactgtgaccccaacccatgcctgaac
ggtggctcgtgccaagacggcgtgggctccttttcctgctcctgcctccctggtttcgcc
ggcccacgatgcgcccgcgatgtggatgagtgcctgagcaacccctgcggcccgggcacc
tgtaccgaccacgtggcctccttcacctgcacctgcccgccaggctacggaggcttccac
tgcgaacaggacctgcccgactgcagccccagctcctgcttcaatggcgggacctgtgtg
gacggcgtgaactcgttcagctgcctgtgccgtcccggctacacaggagcccactgccaa
catgaggcagacccctgcctctcgcggccctgcctacacgggggcgtctgcagcgccgcc
caccctggcttccgctgcacctgcctcgagagcttcacgggcccgcagtgccagacgctg
gtggattggtgcagccgccagccttgtcaaaacgggggtcgctgcgtccagactggggcc
tattgcctttgtccccctggatggagcggacgcctctgtgacatccgaagcttgccctgc
agggaggccgcagcccagatcggggtgcggctggagcagctgtgtcaggcgggtgggcag
tgtgtggatgaagacagctcccactactgcgtgtgcccagagggccgtactggtagccac
tgtgagcaggaggtggacccctgcttggcccagccctgccagcatggggggacctgccgt
ggctatatggggggctacatgtgtgagtgtcttcctggctacaatggtgataactgtgag
gacgacgtggacgagtgtgcctcccagccctgccagcacgggggttcatgcattgacctc
gtggcccgctatctctgctcctgtcccccaggaacgctgggggtgctctgcgagattaat
gaggatgactgcggcccaggcccaccgctggactcagggccccggtgcctacacaatggc
acctgcgtggacctggtgggtggtttccgctgcacctgtcccccaggatacactggtttg
cgctgcgaggcagacatcaatgagtgtcgctcaggtgcctgccacgcggcacacacccgg
gactgcctgcaggacccaggcggaggtttccgttgcctttgtcatgctggcttctcaggt
cctcgctgtcagactgtcctgtctccctgcgagtcccagccatgccagcatggaggccag
tgccgtcctagcccgggtcctgggggtgggctgaccttcacctgtcactgtgcccagccg
ttctggggtccgcgttgcgagcgggtggcgcgctcctgccgggagctgcagtgcccggtg
ggcgtcccatgccagcagacgccccgcgggccgcgctgcgcctgccccccagggttgtcg
ggaccctcctgccgcagcttcccggggtcgccgccgggggccagcaacgccagctgcgcg
gccgccccctgtctccacgggggctcctgccgccccgcgccgctcgcgcccttcttccgc
tgcgcttgcgcgcagggctggaccgggccgcgctgcgaggcgcccgccgcggcacccgag
gtctcggaggagccgcggtgcccgcgcgccgcctgccaggccaagcgcggggaccagcgc
tgcgaccgcgagtgcaacagcccaggctgcggctgggacggcggcgactgctcgctgagc
gtgggcgacccctggcggcaatgcgaggcgctgcagtgctggcgcctcttcaacaacagc
cgctgcgaccccgcctgcagctcgcccgcctgcctctacgacaacttcgactgccacgcc
ggtggccgcgagcgcacttgcaacccggtgtacgagaagtactgcgccgaccactttgcc
gacggccgctgcgaccagggctgcaacacggaggagtgcggctgggatgggctggattgt
gccagcgaggtgccggccctgctggcccgcggcgtgctggtgctcacagtgctgctgccg
ccagaggagctactgcgttccagcgccgactttctgcagcggctcagcgccatcctgcgc
acctcgctgcgcttccgcctggacgcgcacggccaggccatggtcttcccttaccaccgg
cctagtcctggctccgaaccccgggcccgtcgggagctggcccccgaggtgatcggctcg
gtagtaatgctggagattgacaaccggctctgcctgcagtcgcctgagaatgatcactgc
ttccccgatgcccagagcgccgctgactacctgggagcgttgtcagcggtggagcgcctg
gacttcccgtacccactgcgggacgtgcggggggagccgctggagcctccagaacccagc
gtcccgctgctgccactgctagtggcgggcgctgtcttgctgctggtcattctcgtcctg
ggtgtcatggtggcccggcgcaagcgcgagcacagcaccctctggttccctgagggcttc
tcactgcacaaggacgtggcctctggtcacaagggccggcgggaacccgtgggccaggac
gcgctgggcatgaagaacatggccaagggtgagagcctgatgggggaggtggccacagac
tggatggacacagagtgcccagaggccaagcggctaaaggtagaggagccaggcatgggg
gctgaggaggctgtggattgccgtcagtggactcaacaccatctggttgctgctgacatc
cgcgtggcaccagccatggcactgacaccaccacagggcgacgcagatgctgatggcatg
gatgtcaatgtgcgtggcccagatggcttcaccccgctaatgctggcttccttctgtggg
ggggctctggagccaatgccaactgaagaggatgaggcagatgacacatcagctagcatc
atctccgacctgatctgccagggggctcagcttggggcacggactgaccgtactggcgag
actgctttgcacctggctgcccgttatgcccgtgctgatgcagccaagcggctgctggat
gctggggcagacaccaatgcccaggaccactcaggccgcactcccctgcacacagctgtc
acagccgatgcccagggtgtcttccagattctcatccgaaaccgctctacagacttggat
gcccgcatggcagatggctcaacggcactgatcctggcggcccgcctggcagtagagggc
atggtggaagagctcatcgccagccatgctgatgtcaatgctgtggatgagcttgggaaa
tcagccttacactgggctgcggctgtgaacaacgtggaagccactttggccctgctcaaa
aatggagccaataaggacatgcaggatagcaaggaggagacccccctattcctggccgcc
cgcgagggcagctatgaggctgccaagctgctgttggaccactttgccaaccgtgagatc
accgaccacctggacaggctgccgcgggacgtagcccaggagagactgcaccaggacatc
gtgcgcttgctggatcaacccagtgggccccgcagcccccccggtccccacggcctgggg
cctctgctctgtcctccaggggccttcctccctggcctcaaagcggcacagtcggggtcc
aagaagagcaggaggccccccgggaaggcggggctggggccgcaggggccccgggggcgg
ggcaagaagctgacgctggcctgcccgggccccctggctgacagctcggtcacgctgtcg
cccgtggactcgctggactccccgcggcctttcggtgggccccctgcttcccctggtggc
ttcccccttgaggggccctatgcagctgccactgccactgcagtgtctctggcacagctt
ggtggcccaggccgggcgggtctagggcgccagccccctggaggatgtgtactcagcctg
ggcctgctgaaccctgtggctgtgcccctcgattgggcccggctgcccccacctgcccct
ccaggcccctcgttcctgctgccactggcgccgggaccccagctgctcaacccagggacc
cccgtctccccgcaggagcggcccccgccttacctggcagtcccaggacatggcgaggag
tacccggcggctggggcacacagcagccccccaaaggcccgcttcctgcgggttcccagt
gagcacccttacctgaccccatcccccgaatcccctgagcactgggccagcccctcacct
ccctccctctcagactggtccgaatccacgcctagcccagccactgccactggggccatg
gccaccaccactggggcactgcctgcccagccacttcccttgtctgttcccagctccctt
gctcaggcccagacccagctggggccccagccggaagttacccccaagaggcaagtgttg
gcctga

DBGET integrated database retrieval system