KEGG   Homo sapiens (human): 486Help
Entry
486               CDS       T01001                                 

Gene name
FXYD2, ATP1G1, HOMG2
Definition
FXYD domain containing ion transport regulator 2
Orthology
K01538  
sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Disease
H01210  
Hypomagnesemia
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23
AA seq 66 aa AA seqDB search
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgactgggttgtcgatggacggtggcggcagccccaagggggacgtggacccgttctac
tatgactatgagaccgttcgcaatgggggcctgatcttcgctggactggccttcatcgtg
gggctcctcatcctcctcagcagaagattccgctgtgggggcaataagaagcgcaggcaa
atcaatgaagatgagccgtaa

DBGET integrated database retrieval system