KEGG   Homo sapiens (human): 486Help
Entry
486               CDS       T01001                                 

Gene name
FXYD2, ATP1G1, HOMG2
Definition
FXYD domain containing ion transport regulator 2
Orthology
K01538  
sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Disease
H01210  
Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    486 (FXYD2)
   04022 cGMP - PKG signaling pathway
    486 (FXYD2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    486 (FXYD2)
   04918 Thyroid hormone synthesis
    486 (FXYD2)
   04919 Thyroid hormone signaling pathway
    486 (FXYD2)
  Circulatory system
   04260 Cardiac muscle contraction
    486 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    486 (FXYD2)
  Digestive system
   04970 Salivary secretion
    486 (FXYD2)
   04972 Pancreatic secretion
    486 (FXYD2)
   04976 Bile secretion
    486 (FXYD2)
   04973 Carbohydrate digestion and absorption
    486 (FXYD2)
   04974 Protein digestion and absorption
    486 (FXYD2)
   04978 Mineral absorption
    486 (FXYD2)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    486 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    486 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    486 (FXYD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   486 (FXYD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23
AA seq 66 aa AA seqDB search
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgactgggttgtcgatggacggtggcggcagccccaagggggacgtggacccgttctac
tatgactatgagaccgttcgcaatgggggcctgatcttcgctggactggccttcatcgtg
gggctcctcatcctcctcagcagaagattccgctgtgggggcaataagaagcgcaggcaa
atcaatgaagatgagccgtaa

DBGET integrated database retrieval system