KEGG   Homo sapiens (human): 4862Help
Entry
4862              CDS       T01001                                 

Gene name
NPAS2, MOP4, PASD4, bHLHe9
Definition
neuronal PAS domain protein 2
Orthology
K09026  
neuronal PAS domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Class
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q11.2
AA seq 824 aa AA seqDB search
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatgagaaagacagagccaagagagcttctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagttccatgctccctggcaacacg
cggaaaatggacaaaaccaccgtgttggaaaaggtcatcggatttttgcagaaacacaat
gaagtctcagcgcaaacggaaatctgtgacattcagcaagactggaagccttcattcctc
agtaatgaagaattcacccagctgatgttggaggcattagatggcttcattatcgcagtg
acaacagacggcagcatcatctatgtctctgacagtatcacgcctctccttgggcattta
ccgtcggatgtcatggatcagaatttgttaaatttcctcccagaacaagaacattcagaa
gtttataaaatcctttcttcccatatgcttgtgacggattccccctccccagaatactta
aaatctgacagcgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttatgaatacataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggttttgacaacaccctttcaagaccttgccgggtgccacta
ggaaaggaggtttgcttcattgccaccgttcgtctggcaacaccacaattcttaaaggaa
atgtgcatagttgacgaacctttagaggaattcacttcaaggcatagcttggaatggaaa
tttttatttctggatcacagagcacctccaatcataggatacctgccttttgaagtgctg
ggaacctcaggctatgactactaccacattgatgacctggagctcctggccaggtgtcac
cagcacctgatgcagtttggcaaagggaagtcgtgttgctaccggtttctgaccaaaggt
cagcagtggatctggctgcagactcactactacatcacctaccatcagtggaactccaag
cccgagttcatcgtgtgcacacactcggtggtcagttacgcagatgtccgggtggaaagg
aggcaggagctggctctggaagacccgccatccgaggccctccactcctcagcactaaag
gacaagggctcaagcctggaacctcggcagcactttaacacactcgacgtgggtgcctcg
ggccttaataccagtcattcgccatcggcgtcctcaagaagttcccacaaatcctcgcac
acagccatgtcagaacccacctccactcccaccaagctgatggcagaggccagcaccccg
gctttgccaagatcagccaccctgccccaagagttacctgtccccgggctcagccaggca
gccaccatgccggcccctctgccttccccatcgtcctgcgacctcacacagcagctcctg
cctcagaccgttctgcagagcacgcccgctcccatggcacagttttcggcacagttcagc
atgttccagaccatcaaagaccagctagagcagcggacgcggatcctgcaggccaatatc
cggtggcaacaggaagagctccacaagatccaggagcagctctgcctggtccaggactcc
aacgtccagatgttcctgcagcagccagctgtatccctgagcttcagcagcacccagcga
cctgaggctcagcagcagctacagcaaaggtcagctgcagtgactcagccccagctcggg
gcgggcccccaacttccagggcagatctcctctgcccaggtcacaagccagcacctgctc
agagaatcaagtgtgatatcaacccagggtccaaagccaatgagaagctcacagctaatg
cagagcagcggccgctctggaagcagcctagtgtccccgttcagcagcgccacagctgcg
ctcccgccaagtctgaatctgaccacacctgcttccacctcccaggatgccagccagtgc
cagcccagcccagacttcagccatgatcggcagctcaggctgttgctgagccagcccatc
cagcccatgatgcccgggtcctgtgacgcaaggcagccctcggaagtcagcaggacggga
cggcaagtcaagtacgcccagagccagaccgtgtttcaaaatccagacgcacaccccgcc
aacagcagcagcgccccgatgcccgtcctgctgatggggcaggcggtgctccaccccagc
ttccctgcctcccaaccatcgcccctgcagcctgcacaggcccggcagcagccaccgcag
cactacctgcaggtacaggcaccaacctctttgcacagtgagcagcaggactcgctactt
ctctccacctactcacaacagccagggaccctgggctacccccaaccacccccagcacag
ccccagcccctacgtcctccccgaagggtcagcagtctgtctgagtcgtcaggcctccag
cagccgccccgataa

DBGET integrated database retrieval system