KEGG   Homo sapiens (human): 487Help
Entry
487               CDS       T01001                                 

Gene name
ATP2A1, ATP2A, SERCA1
Definition
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (EC:3.6.3.8)
Orthology
K05853  
Ca2+ transporting ATPase, sarcoplasmic/endoplasmic reticulum [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Pancreatic secretion
Alzheimer's disease
Disease
H01129  
Brody myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    487 (ATP2A1)
   04022 cGMP - PKG signaling pathway
    487 (ATP2A1)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    487 (ATP2A1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    487 (ATP2A1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     487 (ATP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.1
AA seq 869 aa AA seqDB search
MGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESV
SVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQD
KTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVA
AIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCK
MFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSL
DFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTL
EFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKI
MAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRK
EVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAE
QREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTA
VAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPE
ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVG
AATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLV
TIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLT
QWLMVLKISLPVIGLDEILKFVARNYLEG
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtctaccgggctgaccgcaagtcagtgcaaaggatcaaggctcgggacatc
gtccctggggacatcgtggaggtggctgtgggggacaaagtccctgcagacatccgaatc
ctcgccatcaaatccaccacgctgcgggttgaccagtccatcctgacaggcgagtctgta
tctgtcatcaaacacacggagcccgttcctgacccccgagctgtcaaccaggacaagaag
aacatgcttttctcgggcaccaacattgcagccggcaaggccttgggcatcgtggccacc
actggtgtgggcaccgagattgggaagatccgagaccaaatggctgccacagaacaggac
aagacccccttgcagcagaagctggatgagtttggggagcagctctccaaggtcatctcc
ctcatctgtgtggctgtctggcttatcaacattggccacttcaacgaccccgtccatggg
ggctcctggttccgcggggccatctactactttaagattgccgtggccttggctgtggct
gccatccccgaaggtcttcctgcagtcatcaccacctgcctggccctgggtacccgtcgg
atggcaaagaagaatgccattgtaagaagcttgccctccgtagagaccctgggctgcacc
tctgtcatctgttccgacaagacaggcaccctcaccaccaaccagatgtctgtctgcaag
atgtttatcattgacaaggtggatggggacatctgcctcctgaatgagttctccatcacc
ggctccacttacgctccagagggagaggtcttgaagaatgataagccagtccggccaggg
cagtatgacgggctggtggagctggccaccatctgtgccctctgcaatgactcctccttg
gacttcaacgaggccaaaggtgtctatgagaaggtcggcgaggccaccgagacagcactc
accaccctggtggagaagatgaatgtgttcaacacggatgtgagaagcctctcgaaggtg
gagagagccaacgcctgcaactcggtgatccgccagctaatgaagaaggaattcaccctg
gagttctcccgagacagaaagtccatgtctgtctattgctccccagccaaatcttcccgg
gctgctgtgggcaacaagatgtttgtcaagggtgcccctgagggcgtcatcgaccgctgt
aactatgtgcgagttggcaccacccgggtgccactgacggggccggtgaaggaaaagatc
atggcggtgatcaaggagtggggcactggccgggacaccctgcgctgcttggccctggcc
acccgggacacccccccgaagcgagaggaaatggtcctggatgactctgccaggttcctg
gagtatgagacggacctgacattcgtgggtgtagtgggcatgctggaccctccgcgcaag
gaggtcacgggctccatccagctgtgccgtgacgccgggatccgggtgatcatgatcact
ggggacaacaagggcacagccattgccatctgccggcgaattggcatctttggggagaac
gaggaggtggccgatcgcgcctacacgggccgagagttcgacgacctgcccctggctgaa
cagcgggaagcctgccgacgtgcctgctgcttcgcccgtgtggagccctcgcacaagtcc
aagattgtggagtacctgcagtcctacgatgagatcacagccatgacaggtgatggcgtc
aatgacgcccctgccctgaagaaggctgagattggcattgccatgggatctggcactgcc
gtggccaagactgcctctgagatggtgctggctgacgacaacttctccaccatcgtagct
gctgtggaggagggccgcgccatctacaacaacatgaagcagttcatccgctacctcatt
tcctccaacgtgggcgaggtggtctgtatcttcctgaccgctgccctggggctgcctgag
gccctgatcccggtgcagctgctatgggtgaacttggtgaccgacgggctcccagccaca
gccctgggcttcaacccaccagacctggacatcatggaccgccccccccggagccccaag
gagcccctcatcagtggctggctcttcttccgctacatggcaatcgggggctatgtgggt
gcagccaccgtgggagcagctgcctggtggttcctgtacgctgaggatgggcctcatgtc
aactacagccagctgactcacttcatgcagtgcaccgaggacaacacccactttgagggc
atagactgtgaggtcttcgaggcccccgagcccatgaccatggccctgtccgtgctggtg
accatcgagatgtgcaatgcactgaacagcctgtccgagaaccagtccctgctgcggatg
ccaccctgggtgaacatctggctgctgggctccatctgcctctccatgtccctgcacttc
ctcatcctctatgttgaccccctgccgatgatcttcaagctccgggccctggacctcacc
cagtggctcatggtcctcaagatctcactgccagtcattgggctcgacgaaatcctcaag
ttcgttgctcggaactacctagagggataa

DBGET integrated database retrieval system