KEGG   Homo sapiens (human): 4878Help
Entry
4878              CDS       T01001                                 

Gene name
NPPA, ANF, ANP, ATFB6, ATRST2, CDD-ANF, PND
Definition
natriuretic peptide A
Orthology
K12334  
natriuretic peptide A
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Disease
H00731  
Atrial fibrillation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    4878 (NPPA)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    4878 (NPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.21
AA seq 151 aa AA seqDB search
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagctccttctccaccaccaccgtgagcttcctccttttactggcattccagctccta
ggtcagaccagagctaatcccatgtacaatgccgtgtccaacgcagacctgatggatttc
aagaatttgctggaccatttggaagaaaagatgcctttagaagatgaggtcgtgccccca
caagtgctcagtgagccgaatgaagaagcgggggctgctctcagccccctccctgaggtg
cctccctggaccggggaagtcagcccagcccagagagatggaggtgccctcgggcggggc
ccctgggactcctctgatcgatctgccctcctaaaaagcaagctgagggcgctgctcact
gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc
cagagcggactgggctgtaacagcttccggtactga

DBGET integrated database retrieval system