KEGG   Homo sapiens (human): 489Help
Entry
489               CDS       T01001                                 

Gene name
ATP2A3, SERCA3
Definition
ATPase, Ca++ transporting, ubiquitous (EC:3.6.3.8)
Orthology
K05853  
Ca2+ transporting ATPase, sarcoplasmic/endoplasmic reticulum [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Pancreatic secretion
Alzheimer's disease
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 999 aa AA seqDB search
MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT
SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGML
DPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDD
LSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAI
GVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEALKYLSRNHMHEEMSQK
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgcatctgctcccggccgccgacgtgctgcgccacttctcggtgacagcc
gagggcggcctgagcccggcgcaggtgaccggcgcgcgggagcgctacggccccaacgag
ctcccgagtgaggaagggaagtccctgtgggagctggtgctggaacagtttgaggacctc
ctggtgcgcatcctgctgctggctgcccttgtctcctttgtcctggcctggttcgaggag
ggcgaggagaccacgaccgccttcgtggagcccctggtcatcatgctgatcctcgtggcc
aacgccattgtgggcgtgtggcaggaacgcaacgccgagagtgccatcgaggccctgaag
gagtatgagcctgagatgggcaaggtgatccgctcggaccgcaagggcgtgcagaggatc
cgtgcccgggacatcgtcccaggggacattgtagaagtggcagtgggggacaaagtgcct
gctgacctccgcctcatcgagatcaagtccaccacgctgcgagtggaccagtccatcctg
acgggtgaatctgtgtccgtgaccaagcacacagaggccatcccagaccccagagctgtg
aaccaggacaagaagaacatgctgttttctggcaccaatatcacatcgggcaaagcggtg
ggtgtggccgtggccaccggcctgcacacggagctgggcaagatccggagccagatggcg
gcagtcgagcccgagcggacgccgctgcagcgcaagctggacgagtttggacggcagctg
tcccacgccatctctgtgatctgcgtggccgtgtgggtcatcaacatcggccacttcgcc
gacccggcccacggtggctcctggctgcgtggcgctgtctactacttcaagatcgccgtg
gccctggcggtggcggccatccccgagggcctcccggctgtcatcactacatgcctggca
ctgggcacgcggcgcatggcacgcaagaacgccatcgtgcgaagcctgccgtccgtggag
accctgggctgcacctcagtcatctgctccgacaagacgggcacgctcaccaccaatcag
atgtctgtctgccggatgttcgtggtagccgaggccgatgcgggctcctgccttttgcac
gagttcaccatctcgggtaccacgtatacccccgagggcgaagtgcggcagggggatcag
cctgtgcgctgcggccagttcgacgggctggtggagctggcgaccatctgcgccctgtgc
aacgactcggctctggactacaacgaggccaagggtgtgtatgagaaggtgggagaggcc
acggagacagctctgacttgcctggtggagaagatgaacgtgttcgacaccgacctgcag
gctctgtcccgggtggagcgagctggcgcctgtaacacggtcatcaagcagctgatgcgg
aaggagttcaccctggagttctcccgagaccggaaatccatgtccgtgtactgcacgccc
acccgccctcaccctactggccagggcagcaagatgtttgtgaagggggctcctgagagt
gtgatcgagcgctgtagctcagtccgcgtggggagccgcacagcacccctgacccccacc
tccagggagcagatcctggcaaagatccgggattggggctcaggctcagacacgctgcgc
tgcctggcactggccacccgggacgcgcccccaaggaaggaggacatggagctggacgac
tgcagcaagtttgtgcagtacgagacggacctgaccttcgtgggctgcgtaggcatgctg
gacccgccgcgacctgaggtggctgcctgcatcacacgctgctaccaggcgggcatccgc
gtggtcatgatcacgggggataacaaaggcactgccgtggccatctgccgcaggcttggc
atctttggggacacggaagacgtggcgggcaaggcctacacgggccgcgagtttgatgac
ctcagccccgagcagcagcgccaggcctgccgcaccgcccgctgcttcgcccgcgtggag
cccgcacacaagtcccgcatcgtggagaacctgcagtcctttaacgagatcactgctatg
actggcgatggagtgaacgacgcaccagccctgaagaaagcagagatcggcatcgccatg
ggctcaggcacggccgtggccaagtcggcggcagagatggtgctgtcagatgacaacttt
gcctccatcgtggctgcggtggaggagggccgggccatctacagcaacatgaagcaattc
atccgctacctcatctcctccaatgttggcgaggtcgtctgcatcttcctcacggcaatt
ctgggcctgcccgaagccctgatccctgtgcagctgctctgggtgaacctggtgacagac
ggcctacctgccacggctctgggcttcaacccgccagacctggacatcatggagaagctg
ccccggagcccccgagaagccctcatcagtggctggctcttcttccgatacctggctatc
ggagtgtacgtaggcctggccacagtggctgccgccacctggtggtttgtgtatgacgcc
gagggacctcacatcaacttctaccagctgaggaacttcctgaagtgctccgaagacaac
ccgctctttgccggcatcgactgtgaggtgttcgagtcacgcttccccaccaccatggcc
ttgtccgtgctcgtgaccattgaaatgtgcaatgccctcaacagcgtctcggagaaccag
tcgctgctgcggatgccgccctggatgaacccctggctgctggtggctgtggccatgtcc
atggccctgcacttcctcatcctgctcgtgccgcccctgcctctcattttccaggtgacc
ccactgagcgggcgccagtgggtggtggtgctccagatatctctgcctgtcatcctgctg
gatgaggccctcaagtacctgtcccggaaccacatgcacgaagaaatgagccagaagtga

DBGET integrated database retrieval system