KEGG   Homo sapiens (human): 4893Help
Entry
4893              CDS       T01001                                 

Gene name
NRAS, ALPS4, CMNS, N-ras, NCMS, NRAS1, NS6
Definition
neuroblastoma RAS viral (v-ras) oncogene homolog
Orthology
K07828  
GTPase NRas
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Axon guidance
VEGF signaling pathway
Tight junction
Gap junction
Signaling pathways regulating pluripotency of stem cells
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Alcoholism
Hepatitis C
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Disease
H00003  
Acute myeloid leukemia (AML)
H00010  
Multiple myeloma
H00016  
Oral cancer
H00032  
Thyroid cancer
H00033  
Adrenal carcinoma
H00038  
Malignant melanoma
H00048  
Hepatocellular carcinoma
H00108  
Autoimmune lymphoproliferative syndromes (ALPS)
H00523  
Noonan syndrome and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4893 (NRAS)
   04015 Rap1 signaling pathway
    4893 (NRAS)
   04010 MAPK signaling pathway
    4893 (NRAS)
   04012 ErbB signaling pathway
    4893 (NRAS)
   04370 VEGF signaling pathway
    4893 (NRAS)
   04068 FoxO signaling pathway
    4893 (NRAS)
   04151 PI3K-Akt signaling pathway
    4893 (NRAS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4893 (NRAS)
  Cellular commiunity
   04530 Tight junction
    4893 (NRAS)
   04540 Gap junction
    4893 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    4893 (NRAS)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    4893 (NRAS)
   04660 T cell receptor signaling pathway
    4893 (NRAS)
   04662 B cell receptor signaling pathway
    4893 (NRAS)
   04664 Fc epsilon RI signaling pathway
    4893 (NRAS)
   04062 Chemokine signaling pathway
    4893 (NRAS)
  Endocrine system
   04910 Insulin signaling pathway
    4893 (NRAS)
   04912 GnRH signaling pathway
    4893 (NRAS)
   04915 Estrogen signaling pathway
    4893 (NRAS)
   04917 Prolactin signaling pathway
    4893 (NRAS)
   04921 Oxytocin signaling pathway
    4893 (NRAS)
   04919 Thyroid hormone signaling pathway
    4893 (NRAS)
   04916 Melanogenesis
    4893 (NRAS)
  Nervous system
   04725 Cholinergic synapse
    4893 (NRAS)
   04726 Serotonergic synapse
    4893 (NRAS)
   04720 Long-term potentiation
    4893 (NRAS)
   04730 Long-term depression
    4893 (NRAS)
   04722 Neurotrophin signaling pathway
    4893 (NRAS)
  Development
   04360 Axon guidance
    4893 (NRAS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4893 (NRAS)
   05206 MicroRNAs in cancer
    4893 (NRAS)
   05205 Proteoglycans in cancer
    4893 (NRAS)
   05203 Viral carcinogenesis
    4893 (NRAS)
   05214 Glioma
    4893 (NRAS)
   05216 Thyroid cancer
    4893 (NRAS)
   05221 Acute myeloid leukemia
    4893 (NRAS)
   05220 Chronic myeloid leukemia
    4893 (NRAS)
   05218 Melanoma
    4893 (NRAS)
   05211 Renal cell carcinoma
    4893 (NRAS)
   05219 Bladder cancer
    4893 (NRAS)
   05215 Prostate cancer
    4893 (NRAS)
   05213 Endometrial cancer
    4893 (NRAS)
   05223 Non-small cell lung cancer
    4893 (NRAS)
  Substance dependence
   05034 Alcoholism
    4893 (NRAS)
  Infectious diseases
   05166 HTLV-I infection
    4893 (NRAS)
   05161 Hepatitis B
    4893 (NRAS)
   05160 Hepatitis C
    4893 (NRAS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4893 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   4893 (NRAS)
  Exosomal proteins of breast cancer cells
   4893 (NRAS)
  Exosomal proteins of colorectal cancer cells
   4893 (NRAS)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    4893 (NRAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.2
AA seq 189 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaagtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system