KEGG   Homo sapiens (human): 490Help
Entry
490               CDS       T01001                                 

Gene name
ATP2B1, PMCA1, PMCA1kb
Definition
ATPase, Ca++ transporting, plasma membrane 1 (EC:3.6.3.8)
Orthology
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Pancreatic secretion
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    490 (ATP2B1)
   04024 cAMP signaling pathway
    490 (ATP2B1)
   04022 cGMP - PKG signaling pathway
    490 (ATP2B1)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    490 (ATP2B1)
  Digestive system
   04970 Salivary secretion
    490 (ATP2B1)
   04972 Pancreatic secretion
    490 (ATP2B1)
   04978 Mineral absorption
    490 (ATP2B1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    490 (ATP2B1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     490 (ATP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q21.3
AA seq 1176 aa AA seqDB search
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGSSIQGALRRQPSI
ASQHHDVTNISTPTHVVFSSSTASTTVGYSSGECIS
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcttacagtggtgtgaaaaactctttgaaggaa
gctaatcatgatggagactttggaattacgctcgcagagctgcgggctctcatggagctc
aggtccacagatgcattacgaaaaatacaggaaagctatggagatgtctatggaatttgc
accaaattgaaaacatctcccaatgaaggtttaagtggaaaccctgcagatttagaaaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacctttcttcaa
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcattgggcctttctttttatcagcctccagaaggggataatgcactttgtggagaagtt
tctgttggggaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctc
ttgtctgtagtgtgtgtggtgttagtaacagctttcaatgactggagtaaggaaaaacag
tttagaggtttgcagagccgaattgaacaagaacagaagttcactgtcatcaggggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgctcaagtgaaatat
ggtgatcttcttccagctgacggcatacttattcaaggcaacgatcttaaaattgatgaa
agctcattgactggtgaatcagatcatgttaaaaagtctttagataaggatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtagttacagctgtaggtgta
aattctcaaactggaattatctttaccttacttggagctggaggtgaagaggaagagaag
aaagatgagaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aacaaagcaaaagcccaggatggtgcagccatggaaatgcagccattgaagagtgaagaa
ggtggagatggtgatgaaaaagataaaaagaaagcaaatttgccaaaaaaggaaaaatct
gttttacaagggaaacttacaaaactggctgttcagattggcaaagcaggtctgttgatg
tctgccatcacagttatcattctagtattatattttgtcattgacaccttctgggttcag
aaaagaccatggcttgctgagtgcacaccaatttatatacaatactttgtgaagttcttc
attattggagttacagttttagtggtcgcagtgccagaaggtcttccacttgcagtcacg
atctcactggcttattcagtcaaaaaaatgatgaaagataataacttagtaaggcatctg
gatgcttgtgaaaccatgggaaatgctacagctatttgttcagataaaacaggaactttg
acaatgaacagaatgacagtcgttcaagcttacataaatgaaaaacattataaaaaggtt
cctgaaccagaagctattccaccaaatattttgtcctatcttgtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcac
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaaacgggattat
caggatgttagaaatgaaataccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctgaaaaattcagatggaagttatcgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtattcagaccaagggaccgtgatgatattgtaaaaactgtgattgaaccgatg
gcatcagaaggcttgagaaccatatgtcttgcattcagagattttccagcaggagaacca
gaaccagagtgggataatgaaaatgatattgtcaccggccttacatgcattgctgttgtg
gggattgaagatcctgtgagacctgaggtgccagatgcaattaaaaagtgtcagagggct
ggaattactgtgcggatggtcactggtgataatattaatactgctcgggccattgctacc
aaatgtggtattttacatcctggggaagattttctgtgcctagaaggtaaagattttaac
agaagaatacgaaatgaaaaaggagagattgagcaagagaggatagacaagatttggcca
aaacttcgagtacttgcaagatcatctcctactgataagcatacactggttaaaggtata
attgacagcactgtctcagaccaacgccaggttgtagctgtaactggtgatggtacaaat
gatggcccagcactaaagaaagcagatgttggatttgcaatgggtattgctggaactgat
gtagctaaagaagcatccgatattattctcacagatgacaactttacaagcattgttaaa
gcagttatgtggggacgaaatgtctatgacagcatctcaaaattccttcagttccaactt
actgttaatgtagtagcagtgattgttgcttttacgggcgcctgcattactcaagactca
ccgcttaaggctgtgcagatgctgtgggtaaacctcataatggatacactcgcttccctg
gctctggcaacggaaccacccactgagtctctcttgcttcggaaaccttatggtagaaat
aagcctctcatctcacgtacaatgatgaagaatattttgggtcatgcattctatcaactt
gtagtagtctttacactcttatttgctggagaaaagttttttgacattgatagtggaaga
aatgctcctttgcatgctcctccttcagaacattatactattgtttttaatacctttgtg
ctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtattc
gaaggaatctttaacaatgccatcttctgcacaattgttttaggcacttttgtggtacag
ataataattgtgcagtttggtggaaaacctttcagttgttcagaactttcaatagaacag
tggctatggtcaatattcctaggaatgggaacattactctggggccagcttatttcaaca
attccaactagccgtttaaaattcctcaaagaagctggtcatggaacacaaaaggaagaa
atacctgaggaggaattagcagaggatgttgaagagattgatcacgctgaaagggagttg
cggcgtggccaaatcttgtggtttagaggtctgaacagaatccaaacacagatggatgta
gtgaatgctttccagagtggaagttccattcagggggctctaaggcggcaaccctccatc
gccagccagcatcatgatgtaacaaatatttctacccctacacatgtagtgttttcctct
tctactgcttctactactgtggggtattcgagtggtgaatgcatttcgtag

DBGET integrated database retrieval system