KEGG   Homo sapiens (human): 4905Help
Entry
4905              CDS       T01001                                 

Gene name
NSF, SKD2
Definition
N-ethylmaleimide-sensitive factor (EC:3.6.4.6)
Orthology
K06027  
vesicle-fusing ATPase [EC:3.6.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
GABAergic synapse
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    4905 (NSF)
  Nervous system
   04727 GABAergic synapse
    4905 (NSF)
   04721 Synaptic vesicle cycle
    4905 (NSF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     4905 (NSF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 744 aa AA seqDB search
MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSI
AFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAE
FIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGN
SQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVF
PPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA
NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDG
VEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDF
LASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVL
LEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV
VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNA
FSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQM
DPEYRVRKFLALLREEGASPLDFD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccggagcatgcaagcggcaagatgtcctacagatgaattatctttaaccaat
tgtgcagttgtgaatgaaaaggatttccagtctggccagcatgtgattgtgaggacctct
cccaatcacaggtacacatttacactgaagacacatccatcggtggttccagggagcatt
gcattcagtttacctcagagaaaatgggctgggctttctattgggcaagaaatagaagtc
tccttatatacatttgacaaagccaaacagtgtattggcacaatgaccatcgagattgat
ttcctgcagaaaaaaagcattgactccaacccttatgacaccgacaagatggcagcagaa
tttattcagcaattcaacaaccaggccttctcagtgggacaacagcttgtctttagcttc
aatgaaaagctttttggcttactggtgaaggacattgaagccatggatcctagcatcctg
aagggagagcctgcgacagggaaaaggcagaagattgaagtaggactggttgttggaaac
agtcaagttgcatttgaaaaagcagaaaattcgtcacttaatcttattggcaaagctaaa
accaaggaaaatcgccaatcaattatcaatcctgactggaactttgaaaaaatgggaata
ggaggtctagacaaggaattttcagatattttccgacgagcatttgcttcccgagtattt
cctccagagattgtggagcagatgggttgtaaacatgttaaaggcatcctgttatatgga
cccccaggttgtggtaagactctcttggctcgacagattggcaagatgttgaatgcaaga
gagcccaaagtggtcaatgggccagaaatccttaacaaatatgtgggagaatcagaggct
aacattcgcaaactttttgctgatgctgaagaggagcaaaggaggcttggtgctaacagt
ggtttgcacatcatcatctttgatgaaattgatgccatctgcaagcagagagggagcatg
gctggtagcacgggagttcatgacactgttgtcaaccagttgctgtccaaaattgatggc
gtggagcagctaaacaacatcctagtcattggaatgaccaatagaccagatctgatagat
gaggctcttcttagacctggaagactggaagttaaaatggagataggcttgccagatgag
aaaggccgactacagattcttcacatccacacagcaagaatgagagggcatcagttactc
tctgctgatgtagacattaaagaactggccgtggagaccaagaatttcagtggtgctgaa
ttggagggtctggtgcgagcagcccagtccactgctatgaatagacacataaaggccagt
actaaagtggaagtggacatggagaaagcagaaagcctgcaagtgacgagaggagacttc
cttgcttctttggagaatgatatcaaaccagcctttggcacaaaccaagaagattatgca
agttacattatgaacggtatcatcaaatggggtgacccagttactcgagttctagatgat
ggggagctgctggtgcagcagactaagaacagtgaccgcacaccattggtcagcgtgctt
ctggaaggccctcctcacagtgggaagactgctttagctgcaaaaattgcagaggaatcc
aacttcccgttcatcaagatctgttctcctgataaaatgattggcttttctgaaacagcc
aaatgtcaggccatgaagaagatctttgatgatgcgtacaaatcccagctcagttgtgtg
gttgtggatgacattgagagattgcttgattacgtccctattggccctcgattttcaaat
cttgtattacaggctcttctcgttttactgaaaaaggcacctcctcagggccgcaagctt
cttatcattgggaccactagccgcaaagatgtccttcaggagatggaaatgcttaacgct
ttcagcaccaccatccacgtgcccaacattgccacaggagagcagctgttggaagctttg
gagcttttgggcaacttcaaggataaggaacgcaccacaattgcacagcaagtcaaaggg
aagaaggtctggataggaatcaagaagttactaatgctgatcgagatgtccctacagatg
gatcctgaataccgtgtgagaaaattcttggccctcttaagagaagaaggagctagcccc
cttgattttgattga

DBGET integrated database retrieval system