KEGG   Homo sapiens (human): 4915Help
Entry
4915              CDS       T01001                                 

Gene name
NTRK2, GP145-TrkB, TRKB, trk-B
Definition
neurotrophic tyrosine kinase, receptor, type 2 (EC:2.7.10.1)
Orthology
K04360  
neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Alcoholism
Disease
H00043  
Neuroblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4915 (NTRK2)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4915 (NTRK2)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    4915 (NTRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4915 (NTRK2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Trk family [OT]
   4915 (NTRK2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VII (TRK receptor family)
   4915 (NTRK2)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VII (TRK receptor family)
   4915 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.1
AA seq 477 aa AA seqDB search
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ctggttgtgggcttctggagggccgctttcgcctgtcccacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccgagattggagcct
aacagtgtagatcctgagaacatcaccgaaattttcatcgcaaaccagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttatgtgggactgagaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcatttctgaaaaacagcaacctgcagcacatc
aattttacccgaaacaaactgacgagtttgtctaggaaacatttccgtcaccttgacttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactcaggatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatctgcaaat
ctggccgcacctaacctcactgtggaggaaggaaagtctatcacattatcctgtagtgtg
gcaggtgatccggttcctaatatgtattgggatgttggtaacctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatccgatgacagt
gggaagcagatctcttgtgtggcggaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaaaatacatgttaccaatcacacg
gagtaccacggctgcctccagctggataatcccactcacatgaacaatggggactacact
ctaatagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgacgatggtgcaaacccaaattatcctgatgtaatttatgaagattat
ggaactgcagcgaatgacatcggggacaccacgaacagaagtaatgaaatcccttccaca
gacgtcactgataaaaccggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggtgggattttgccttttggtaatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaaggttttgttttgtttcataagatcccactggatgggtag

DBGET integrated database retrieval system