KEGG   Homo sapiens (human): 492Help
Entry
492               CDS       T01001                                 

Gene name
ATP2B3, CLA2, OPCA, PMCA3, PMCA3a, SCAX1
Definition
ATPase, Ca++ transporting, plasma membrane 3 (EC:3.6.3.8)
Orthology
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    492 (ATP2B3)
   04024 cAMP signaling pathway
    492 (ATP2B3)
   04022 cGMP - PKG signaling pathway
    492 (ATP2B3)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    492 (ATP2B3)
  Digestive system
   04970 Salivary secretion
    492 (ATP2B3)
   04972 Pancreatic secretion
    492 (ATP2B3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     492 (ATP2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 1220 aa AA seqDB search
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatggccaatagttccatcgagttccaccccaagccccagcagcagcgggat
gtcccccaggctggaggctttgggtgcacgctggcggagctgcgcaccctcatggagctg
cgaggggccgaggcgctgcagaagatcgaggaggcctacggggatgtcagcgggctctgc
cggaggctgaagacctcacccacagagggcctggcggacaacaccaatgacctggagaag
cgcaggcagatctacgggcagaacttcatccccccaaagcaacccaagaccttcctgcag
ctggtgtgggaggccctgcaggacgtgaccctcatcatcctggaggtggctgccatcgtc
tctctgggcctctcgttctatgcgccgccaggagaggagagtgaagcctgtgggaatgtg
tcgggaggcgcagaagatgagggcgaggccgaagctggctggatcgagggggctgccatc
ctgctgtccgtcatctgtgtggtgctggtcacggccttcaatgactggagcaaggagaag
cagttccgaggcctgcagagccgaattgagcaggagcagaagttcacggtcatccggaac
gggcagctcctccaggtccccgtggctgcgctggtggtgggggacattgcccaggtcaag
tacggcgacctgctgccagccgacggcgtgctcatccaggccaatgacctcaagatcgac
gagagctccctgacgggcgagtctgaccacgtgcgcaagtcagctgacaaagatcccatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtggtgaccgccgttggc
gtgaattcccagacaggcatcatcttcacgctgcttggagctggcggagaggaggaagag
aagaaagataagaaaggcaagcagcaggatggggccatggagagtagccagaccaaagct
aagaagcaggatggtgcagtggccatggagatgcagcccctgaagagcgcggagggtggg
gagatggaggagcgggagaagaagaaagccaacgcacccaaaaaggagaagtctgtcctt
caggggaagctcacaaagctagccgtgcagatcgggaaagcagggctggtgatgtctgcc
atcaccgtcatcatcctggtcctctactttgtgattgagacgtttgtcgtggaaggccgg
acatggctggcagagtgcacgccggtctatgtacaatacttcgtgaagttcttcatcatt
ggtgtcactgtgctggtcgtggctgtcccagagggcctgcctcttgctgtcaccatctcc
ttagcttactctgtcaagaaaatgatgaaagacaacaacctggtgcgccacctggatgcc
tgcgagaccatgggcaacgccacagccatctgctccgacaagacgggcacgctcaccacc
aaccgtatgaccgtggtccagtcctacctaggagacacccactacaaagagattccggcc
cccagcgccctgacccctaagatcctcgacctcctggtccatgccatctccatcaacagt
gcctataccaccaaaatactacctcctgagaaggaaggcgccctcccacgccaggtgggc
aataagacggagtgcgccctgctgggcttcgtcttggacctgaagcgggacttccagccc
gtgcgcgagcagatcccggaagacaagctttacaaagtgtacaccttcaactcggtccgc
aagtccatgagcacagtcatccgcatgcccgacggtggcttccgcctcttcagcaagggg
gcctcagagatcctcttgaaaaagtgcaccaacatcttgaacagcaatggcgaactccgg
ggctttcggcctcgggaccgggacgacatggtgaggaagatcatcgagccgatggcttgc
gatggcctccgcaccatctgcatcgcctaccgggacttctctgcaggccaggagcccgac
tgggacaacgagaatgaggtcgtgggtgacctcacctgcatagctgtcgtgggcattgag
gaccctgtgcggcccgaggtccctgaagctatccgaaaatgccagcgtgctggcatcaca
gtccgcatggtgactggggacaacatcaacacggcccgggccatcgcagccaaatgcggc
atcatccagcccggggaggacttcctgtgcctagaagggaaggagttcaaccggcggatc
cgcaatgagaaaggcgagatagaacaggagcggctggacaaggtgtggcccaagctgagg
gtgctggcccggtcgtctcccaccgacaagcacacactggtcaaagggattatcgacagc
accactggtgagcagcggcaggtggtggctgtgacaggggatggcaccaacgatgggccg
gccctcaagaaggcggacgtgggcttcgccatgggcatcgcagggaccgacgtggccaag
gaggcctccgacatcatcctgaccgatgacaacttcaccagcatcgtcaaggcagtcatg
tggggccgtaacgtctatgacagcatctccaagttcctgcagtttcaactgacggtcaat
gtggtggctgtgatcgtggccttcacaggtgcctgcattactcaggactctcctctcaaa
gccgtgcagatgttgtgggtgaacttgatcatggacacatttgcctctctggccctggcg
acggagccacccacagagtcgctgctgctgcggaagccgtacggccgcgacaagcccctc
atctcccgcaccatgatgaagaacattctgggccacgccgtgtaccagctcgccatcatc
ttcaccctgctgtttgtcggggagctcttcttcgacatcgacagcgggaggaatgcgccc
ctgcactcgccaccctcagagcactacaccatcatcttcaacacgttcgtcatgatgcag
ctctttaacgagatcaacgcccgcaagatccacggcgagaggaacgtgttcgacggcatc
ttcagcaaccccatcttctgcaccatcgttttgggcactttcgggattcagattgtcatc
gtccagtttggcgggaagcccttcagctgctccccactatccacagaacagtggctctgg
tgcctgtttgttggtgttggggagctggtctggggacaggtcattgccaccatccccacc
agccagctcaagtgcctgaaggaagccgggcacgggcccgggaaggacgagatgaccgac
gaggagctggccgaaggcgaggaagagatcgaccatgccgagcgggagctccgcaggggc
cagatcctctggttccggggcctgaaccggattcagacgcagatccgggtggtgaaagcg
ttccgtagctcgctctatgaaggcctggagaaaccagaatccaagacctccattcacaac
ttcatggccacgcccgagtttctgatcaatgactacacccacaacatcccgctcattgac
gacacggacgtggacgagaacgaggagcgcctccgggcccccccgcccccgtcccccaac
cagaacaacaacgccatagacagcggcatctacctgaccacgcatgtcaccaagtcagct
acctcttcagtgttttcctccagtcccgggagcccgctccacagcgtggagacgtccctc
taa

DBGET integrated database retrieval system