KEGG   Homo sapiens (human): 492Help
Entry
492               CDS       T01001                                 

Gene name
ATP2B3, CFAP39, CLA2, OPCA, PMCA3, PMCA3a, SCAX1
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 3
  KO
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Aldosterone synthesis and secretion
Salivary secretion
Pancreatic secretion
Disease
H01603  
Primary aldosteronism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    492 (ATP2B3)
   04024 cAMP signaling pathway
    492 (ATP2B3)
   04022 cGMP - PKG signaling pathway
    492 (ATP2B3)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    492 (ATP2B3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    492 (ATP2B3)
  Digestive system
   04970 Salivary secretion
    492 (ATP2B3)
   04972 Pancreatic secretion
    492 (ATP2B3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     492 (ATP2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16720(Tdark)
UniProt: 
Position
Xq28
AA seq 1220 aa AA seqDB search
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatggccaatagttccatcgagttccaccccaagccccagcagcagcgggat
gtcccccaggctggaggctttgggtgcacgctggcggagctgcgcaccctcatggagctg
cgaggggccgaggcgctgcagaagatcgaggaggcctacggggatgtcagcgggctctgc
cggaggctgaagacctcacccacagagggcctggcggacaacaccaatgacctggagaag
cgcaggcagatctacgggcagaacttcatccccccaaagcaacccaagaccttcctgcag
ctggtgtgggaggccctgcaggacgtgaccctcatcatcctggaggtggctgccatcgtc
tctctgggcctctcgttctatgcgccgccaggagaggagagtgaagcctgtgggaatgtg
tcgggaggcgcagaagatgagggcgaggccgaagctggctggatcgagggggctgccatc
ctgctgtccgtcatctgtgtggtgctggtcacggccttcaatgactggagcaaggagaag
cagttccgaggcctgcagagccgaattgagcaggagcagaagttcacggtcatccggaac
gggcagctcctccaggtccccgtggctgcgctggtggtgggggacattgcccaggtcaag
tacggcgacctgctgccagccgacggcgtgctcatccaggccaatgacctcaagatcgac
gagagctccctgacgggcgagtctgaccacgtgcgcaagtcagctgacaaagatcccatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtggtgaccgccgttggc
gtgaattcccagacaggcatcatcttcacgctgcttggagctggcggagaggaggaagag
aagaaagataagaaaggcaagcagcaggatggggccatggagagtagccagaccaaagct
aagaagcaggatggtgcagtggccatggagatgcagcccctgaagagcgcggagggtggg
gagatggaggagcgggagaagaagaaagccaacgcacccaaaaaggagaagtctgtcctt
caggggaagctcacaaagctagccgtgcagatcgggaaagcagggctggtgatgtctgcc
atcaccgtcatcatcctggtcctctactttgtgattgagacgtttgtcgtggaaggccgg
acatggctggcagagtgcacgccggtctatgtacaatacttcgtgaagttcttcatcatt
ggtgtcactgtgctggtcgtggctgtcccagagggcctgcctcttgctgtcaccatctcc
ttagcttactctgtcaagaaaatgatgaaagacaacaacctggtgcgccacctggatgcc
tgcgagaccatgggcaacgccacagccatctgctccgacaagacgggcacgctcaccacc
aaccgtatgaccgtggtccagtcctacctaggagacacccactacaaagagattccggcc
cccagcgccctgacccctaagatcctcgacctcctggtccatgccatctccatcaacagt
gcctataccaccaaaatactacctcctgagaaggaaggcgccctcccacgccaggtgggc
aataagacggagtgcgccctgctgggcttcgtcttggacctgaagcgggacttccagccc
gtgcgcgagcagatcccggaagacaagctttacaaagtgtacaccttcaactcggtccgc
aagtccatgagcacagtcatccgcatgcccgacggtggcttccgcctcttcagcaagggg
gcctcagagatcctcttgaaaaagtgcaccaacatcttgaacagcaatggcgaactccgg
ggctttcggcctcgggaccgggacgacatggtgaggaagatcatcgagccgatggcttgc
gatggcctccgcaccatctgcatcgcctaccgggacttctctgcaggccaggagcccgac
tgggacaacgagaatgaggtcgtgggtgacctcacctgcatagctgtcgtgggcattgag
gaccctgtgcggcccgaggtccctgaagctatccgaaaatgccagcgtgctggcatcaca
gtccgcatggtgactggggacaacatcaacacggcccgggccatcgcagccaaatgcggc
atcatccagcccggggaggacttcctgtgcctagaagggaaggagttcaaccggcggatc
cgcaatgagaaaggcgagatagaacaggagcggctggacaaggtgtggcccaagctgagg
gtgctggcccggtcgtctcccaccgacaagcacacactggtcaaagggattatcgacagc
accactggtgagcagcggcaggtggtggctgtgacaggggatggcaccaacgatgggccg
gccctcaagaaggcggacgtgggcttcgccatgggcatcgcagggaccgacgtggccaag
gaggcctccgacatcatcctgaccgatgacaacttcaccagcatcgtcaaggcagtcatg
tggggccgtaacgtctatgacagcatctccaagttcctgcagtttcaactgacggtcaat
gtggtggctgtgatcgtggccttcacaggtgcctgcattactcaggactctcctctcaaa
gccgtgcagatgttgtgggtgaacttgatcatggacacatttgcctctctggccctggcg
acggagccacccacagagtcgctgctgctgcggaagccgtacggccgcgacaagcccctc
atctcccgcaccatgatgaagaacattctgggccacgccgtgtaccagctcgccatcatc
ttcaccctgctgtttgtcggggagctcttcttcgacatcgacagcgggaggaatgcgccc
ctgcactcgccaccctcagagcactacaccatcatcttcaacacgttcgtcatgatgcag
ctctttaacgagatcaacgcccgcaagatccacggcgagaggaacgtgttcgacggcatc
ttcagcaaccccatcttctgcaccatcgttttgggcactttcgggattcagattgtcatc
gtccagtttggcgggaagcccttcagctgctccccactatccacagaacagtggctctgg
tgcctgtttgttggtgttggggagctggtctggggacaggtcattgccaccatccccacc
agccagctcaagtgcctgaaggaagccgggcacgggcccgggaaggacgagatgaccgac
gaggagctggccgaaggcgaggaagagatcgaccatgccgagcgggagctccgcaggggc
cagatcctctggttccggggcctgaaccggattcagacgcagatccgggtggtgaaagcg
ttccgtagctcgctctatgaaggcctggagaaaccagaatccaagacctccattcacaac
ttcatggccacgcccgagtttctgatcaatgactacacccacaacatcccgctcattgac
gacacggacgtggacgagaacgaggagcgcctccgggcccccccgcccccgtcccccaac
cagaacaacaacgccatagacagcggcatctacctgaccacgcatgtcaccaagtcagct
acctcttcagtgttttcctccagtcccgggagcccgctccacagcgtggagacgtccctc
taa

DBGET integrated database retrieval system