KEGG   Homo sapiens (human): 493Help
Entry
493               CDS       T01001                                 

Gene name
ATP2B4, ATP2B2, MXRA1, PMCA4, PMCA4b, PMCA4x
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 4
  KO
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Aldosterone synthesis and secretion
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    493 (ATP2B4)
   04024 cAMP signaling pathway
    493 (ATP2B4)
   04022 cGMP - PKG signaling pathway
    493 (ATP2B4)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    493 (ATP2B4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    493 (ATP2B4)
  Digestive system
   04970 Salivary secretion
    493 (ATP2B4)
   04972 Pancreatic secretion
    493 (ATP2B4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     493 (ATP2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P23634(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 1205 aa AA seqDB search
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKT
SPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLA
VQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRK
CNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDTEPSWDNENEILT
ELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLL
KRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFS
CTSLSLSQWLWCLFIGIGELLWGQFISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEE
ELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQS
LETSV
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacccatcagaccgtgtcttgcctgccaactcgatggccgagagccgtgaaggg
gactttggctgcacagtaatggaactgaggaagctcatggagctgcgttcaagggatgca
ctgacccagattaatgtccactatggaggtgtacagaatctctgcagtagactgaaaacc
tcccctgtggaaggtctgtctgggaaccctgcagatctggagaaacgtaggcaggtgttt
ggacacaacgtgatcccccccaaaaagcccaagactttcttagaattagtgtgggaagct
cttcaagatgtcacgcttatcatcctggagattgcagccatcatctccctggtcctgtcc
ttttatcgccctgctggtgaagaaaatgaactgtgtggtcaagtcgcaactaccccagaa
gatgaaaatgaggcacaagctggctggattgagggggcagccatccttttctcagtgatc
atcgtggtgttagtgactgcctttaatgattggagcaaagagaagcaattccgggggctg
cagtgccgcattgaacaggagcaaaagttctccatcatccgaaacggtcaactcatccag
ctccctgtggctgagattgtggttggtgatattgcccaagtcaaatacggtgatctgctg
cctgcagatggaatcctgatccaagggaatgatctgaagattgatgagagctctctgaca
ggggaatctgaccatgtcaagaagtccctggacaaagaccccatgttgctctcagggacc
catgtcatggaaggttctggccggatggtggtgacagctgttggtgtcaactctcagact
ggaatcatccttactctcttgggggtcaatgaggatgacgaaggggagaaaaagaagaaa
ggtaaaaaacaaggagtccctgaaaatcgcaacaaagcaaagacccaagacggagtggcc
ctggaaatccagccactcaacagccaggagggaatcgacaatgaggaaaaggacaagaag
gcagtcaaggtgcctaaaaaggagaagtcagtgctgcagggcaagctgactcgcctggct
gttcagattgggaaagccggtctgctcatgtctgctctcacggttttcatcctgattcta
tactttgtgattgacaactttgtgataaatcgcagaccatggctccctgagtgtactccc
atctacatccagtactttgtcaagttcttcatcatcggcatcactgtactggtggtggct
gtgccagaggggctgcctctggctgtcaccatctcactggcctactctgtgaagaaaatg
atgaaagacaataacctagtacggcacttggatgcttgtgagaccatgggcaacgccacc
gccatctgctctgataagacaggcacgttgaccatgaaccgcatgactgtggtacaagct
tatattgggggcatccattaccgtcaaatcccaagccctgatgtcttcctgcccaaagtc
ctggacctcattgtcaatggcatttctatcaacagtgcttatacctccaagattctgcct
ccagagaaggagggaggcctgcctcggcaggtgggcaacaagaccgagtgtgctctgcta
ggctttgtcacagatctgaagcaggattatcaggctgtgcgtaatgaagtgcccgaggag
aagctctacaaggtgtacacctttaactcagtgcgcaagtcaatgagcaccgtcatcagg
aatcccaacggtggcttccgtatgtacagcaagggcgcctctgagatcatcttgcgcaag
tgtaatcgaatcctggaccggaaaggggaagcagtgccattcaagaataaagacagagat
gatatggtacgcactgtcatcgagcccatggcctgtgatggactccggactatctgcata
gcttaccgggacttcgatgacacagagccctcttgggacaatgagaatgagatcctcacc
gaactgacctgtatcgcggtggtgggcattgaggaccctgtgcgcccagaggtgccagat
gctattgccaaatgcaaacaagctggcattactgtcagaatggtgacaggtgacaacatc
aacacagcccgggccattgccaccaaatgtggcattctgacacctggggatgacttcctg
tgcttagaaggcaaagaattcaaccggctcatccgcaacgagaaaggcgaggtagagcaa
gaaaagctggacaagatctggcctaagcttcgggtcctggcgcgatcttctcccactgac
aagcacaccctggtgaaaggcataattgacagcactgttggggaacaccggcaggtcgtg
gctgtcactggtgatggcacaaatgacgggcctgctctgaagaaagcggatgttggtttt
gccatgggcatcgcaggcacagatgtagcaaaggaggcttcagacatcatcctaacagat
gacaacttcaccagcattgtgaaggcagtgatgtggggacgaaatgtctatgacagcatc
tccaagttcctgcagttccagctcactgtcaatgtggtggccgtgattgtagccttcact
ggagcctgtatcactcaggattccccattgaaagctgtgcagatgttgtgggttaatctg
atcatggacacttttgcttcattggccctggccacagagccccctacggaatctctgttg
aagcggcgcccctatggccgaaataagcctctgatctcacgcactatgatgaagaacatc
ttgggccatgcattctatcagctcattgtcatctttatccttgtctttgcgggtgagaaa
ttctttgatattgatagtgggaggaaggcacctctacattcaccacccagccagcactat
accattgtttttaacaccttcgtgctgatgcagctcttcaatgaaatcaactcccgaaag
atccatggagagaagaacgtcttttcaggcatctaccgcaacattatcttctgctctgta
gtcttgggcacattcatctgccagattttcatcgtggaatttgggggtaaacccttcagt
tgtacaagcctcagcctgtctcagtggctgtggtgtctcttcattgggattggagaactt
ctgtggggccagttcatctccgcaatacctacccgatccctgaagttcctgaaggaggct
gggcatggcaccaccaaagaggagatcaccaaggatgccgagggactggatgagattgac
catgctgagatggagctgcgccgaggccagatcctctggttccggggcctgaaccgtatc
cagactcagatcaaagtggtcaaagcgttccatagttccctccacgaaagcattcagaaa
ccctacaaccaaaagtccatccacagcttcatgacccaccctgaattcgccatagaggag
gagttgccacgaacaccactcctggatgaggaagaggaggaaaatcctgacaaggcttct
aagtttgggactagggtgctcctgttggatggtgaggtcactccatatgccaatacaaac
aacaatgcggtggattgcaaccaagtgcagctcccccagtcggacagctctctacagagc
ctagagacatcagtttga

DBGET integrated database retrieval system