KEGG   Homo sapiens (human): 4938Help
Entry
4938              CDS       T01001                                 

Gene name
OAS1, IFI-4, OIAS, OIASI
Definition
2'-5'-oligoadenylate synthetase 1, 40/46kDa (EC:2.7.7.84)
Orthology
K14216  
2'-5'-oligoadenylate synthetase
Organism
hsa  Homo sapiens (human)
Pathway
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05162 Measles
    4938 (OAS1)
   05164 Influenza A
    4938 (OAS1)
   05160 Hepatitis C
    4938 (OAS1)
   05168 Herpes simplex infection
    4938 (OAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.2
AA seq 414 aa AA seqDB search
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLTQHTPGSIHPTGRR
GLDLHHPLNASASWGKGLQCYLDQFLHFQVGLLIQRGQSSSVSWCIIQDRTQVS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctcagaaataccccagccaaatctctggacaagttcattgaagactatctc
ttgccagacacgtgtttccgcatgcaaatcaaccatgccattgacatcatctgtgggttc
ctgaaggaaaggtgcttccgaggtagctcctaccctgtgtgtgtgtccaaggtggtaaag
ggtggctcctcaggcaagggcaccaccctcagaggccgatctgacgctgacctggttgtc
ttcctcagtcctctcaccacttttcaggatcagttaaatcgccggggagagttcatccag
gaaattaggagacagctggaagcctgtcaaagagagagagcattttccgtgaagtttgag
gtccaggctccacgctggggcaacccccgtgcgctcagcttcgtactgagttcgctccag
ctcggggagggggtggagttcgatgtgctgcctgcctttgatgccctgggtcagttgact
ggcggctataaacctaacccccaaatctatgtcaagctcatcgaggagtgcaccgacctg
cagaaagagggcgagttctccacctgcttcacagaactacagagagacttcctgaagcag
cgccccaccaagctcaagagcctcatccgcctagtcaagcactggtaccaaaattgtaag
aagaagcttgggaagctgccacctcagtatgccctggagctcctgacggtctatgcttgg
gagcgagggagcatgaaaacacatttcaacacagcccagggatttcggacggtcttggaa
ttagtcataaactaccagcaactctgcatctactggacaaagtattatgactttaaaaac
cccattattgaaaagtacctgagaaggcagctcacgaaacccaggcctgtgatcctggac
ccggcggaccctacaggaaacttgggtggtggagacccaaagggttggaggcagctggca
caagaggctgaggcctggctgaattacccatgctttaagaattgggatgggtccccagtg
agctcctggattctgctgacccagcacactccaggcagcatccaccccacaggcagaaga
ggactggacctgcaccatcctctgaatgccagtgcatcttgggggaaagggctccagtgt
tatctggaccagttccttcattttcaggtgggactcttgatccagagaggacaaagctcc
tcagtgagctggtgtataatccaggacagaacccaggtctcctga

DBGET integrated database retrieval system