KEGG   Homo sapiens (human): 4939Help
Entry
4939              CDS       T01001                                 

Gene name
OAS2
Definition
2'-5'-oligoadenylate synthetase 2, 69/71kDa (EC:2.7.7.84)
Orthology
K14216  
2'-5'-oligoadenylate synthetase
Organism
hsa  Homo sapiens (human)
Pathway
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.2
AA seq 172 aa AA seqDB search
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIG
GSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEI
QKSLDGFTIQVFTKNQRISFEVLAAFNALSKHCWVSGEKSQRSGCQTALCNL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggggagtcccagctgtcctcggtgcctgctcagaagctgggttggtttatc
caggaatacctgaagccctacgaagaatgtcagacactgatcgacgagatggtgaacacc
atctgtgacgtcctgcaggaacccgaacagttccccctggtgcagggagtggccataggt
ggctcctatggacggaaaacagtcttaagaggcaactccgatggtacccttgtcctcttc
ttcagtgacttaaaacaattccaggatcagaagagaagccaacgtgacatcctcgataaa
actggggataagctgaagttctgtctgttcacgaagtggttgaaaaacaatttcgagatc
cagaagtcccttgatgggttcaccatccaggtgttcacaaaaaatcagagaatctctttc
gaggtgctggccgccttcaacgctctgagtaagcattgctgggtgtcaggagagaaaagc
caaagaagcgggtgccagacagctctgtgcaacctctag

DBGET integrated database retrieval system