KEGG   Homo sapiens (human): 501Help
Entry
501               CDS       T01001                                 

Gene name
ALDH7A1, ATQ1, EPD, PDE
Definition
aldehyde dehydrogenase 7 family, member A1 (EC:1.2.1.3 1.2.1.8 1.2.1.31)
Orthology
K14085  
aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Lysine biosynthesis
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H01247  
Pyridoxine-dependent epilepsy (PDE)
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:hsa00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hsa00300]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31
AA seq 539 aa AA seqDB search
MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVG
NPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgccttcctcgcgcgctgtgtgtgcacgctgcaaagaccagcaagctctctgga
ccttggagcaggcctgccgccttcatgtccactctcctcatcaatcagccccagtatgcg
tggctgaaagagctggggctccgcgaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggttattacgacctattgccctgctaacaacgagccaatagcaagagtc
cgacaggccagtgtggcagactatgaagaaactgtaaagaaagcaagagaagcatggaaa
atctgggcagatattcctgctccaaaacgaggagaaatagtaagacagattggcgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtctttggagatggggaaaatctta
gtggaaggtgtgggtgaagttcaggagtatgtggatatctgtgactatgctgttggttta
tcaaggatgattggaggacctatcttgccttctgaaagatctggccatgcactgattgag
cagtggaatcccgtaggcctggttggaatcatcacggcattcaatttccctgtggcagtg
tatggttggaacaacgccatcgccatgatctgtggaaatgtctgcctctggaaaggagct
ccaaccacttccctcattagtgtggctgtcacaaagataatagccaaggttctggaggac
aacaagctgcctggtgcaatttgttccttgacttgtggtggagcagatattggcacagca
atggccaaagatgaacgagtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caggtgggcctgatggtgcaggagaggtttgggagaagtctgttggaacttggaggaaac
aatgccattattgcctttgaagatgcagacctcagcttagttgttccatcagctctcttc
gctgctgtgggaacagctggccagaggtgtaccactgcgaggcgactgtttatacatgaa
agcatccatgatgaggttgtaaacagacttaaaaaggcctatgcacagatccgagttggg
aacccatgggaccctaatgttctctatgggccactccacaccaagcaggcagtgagcatg
tttcttggagcagtggaagaagcaaagaaagaaggtggcacagtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaaccgacaattgtgacaggtcttggccacgat
gcgtccattgcacacacagagacttttgctccgattctctatgtctttaaattcaagaat
gaagaagaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaagatctgggcagaatctttcgctggcttggacctaaaggatcagactgtggcatt
gtaaatgtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaag
cacactggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaaggtct
acttgtactatcaactacagtaaagaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system