KEGG   Homo sapiens (human): 5048Help
Entry
5048              CDS       T01001                                 

Gene name
PAFAH1B1, LIS1, LIS2, MDCR, MDS, NudF, PAFAH
Definition
(RefSeq) platelet activating factor acetylhydrolase 1b regulatory subunit 1
  KO
K16794  
platelet-activating factor acetylhydrolase IB subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Ether lipid metabolism
Metabolic pathways
Disease
H00268  
Lissencephaly (LIS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00565 Ether lipid metabolism
    5048 (PAFAH1B1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    5048 (PAFAH1B1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5048 (PAFAH1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P43034(Tbio)
UniProt: 
Position
17p13.3
AA seq 410 aa AA seqDB search
MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIR
LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF
SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ
GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV
RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSE
TKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK
TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtcccagagacaacgagatgaactaaatcgagctatagcagattatcttcgt
tcaaatggctatgaagaggcatattcagtttttaaaaaggaagctgaattagatgtgaat
gaagaattagataaaaagtatgctggtcttttggaaaaaaaatggacatctgttattaga
ttacaaaagaaggttatggaattagaatcaaagctaaatgaagcaaaagaagaatttacg
tcaggtggacctcttggtcagaaacgagacccaaaagaatggattccccgtccgccagaa
aaatatgcattgagtggtcacaggagtccagtcactcgagtcattttccatcctgtgttc
agtgttatggtctctgcttcagaggatgctacaattaaggtgtgggattatgagactgga
gattttgaacgaactcttaaaggacatacagactctgtacaggacatttcattcgaccac
agcggcaagcttctggcttcctgttctgcagatatgaccattaaactatgggattttcag
ggctttgaatgcatcagaaccatgcacggccatgaccacaatgtttcttcagtagccatc
atgcccaatggagatcatatagtgtctgcctcaagggataaaactataaaaatgtgggaa
gtgcaaactggctactgtgtgaagacattcacaggacacagagaatgggtacgtatggta
cggccaaatcaagatggcactctgatagccagctgttccaatgaccagactgtgcgtgta
tgggtcgtagcaacaaaggaatgcaaggctgagctccgagagcatgagcatgtggtagaa
tgcatttcctgggctccagaaagctcatattcctccatctctgaagcaacaggatctgag
actaaaaaaagtggtaaacctgggccattcttgctgtctggatccagagacaagactatt
aagatgtgggatgtcagtactggcatgtgccttatgaccctcgtgggtcatgataactgg
gtacgtggagttctgttccattctggggggaagtttattttgagttgtgctgatgacaag
accctacgcgtatgggattacaagaacaagcgatgcatgaagaccctcaatgcgcatgaa
cactttgttacctccttggatttccacaagacggcaccctatgtcgtcactggcagcgta
gatcaaacagtaaaagtgtgggagtgccgttga

DBGET integrated database retrieval system