KEGG   Homo sapiens (human): 50487Help
Entry
50487             CDS       T01001                                 

Gene name
PLA2G3, GIII-SPLA2, SPLA2III, sPLA2-III
Definition
phospholipase A2, group III (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    50487 (PLA2G3)
   00565 Ether lipid metabolism
    50487 (PLA2G3)
   00590 Arachidonic acid metabolism
    50487 (PLA2G3)
   00591 Linoleic acid metabolism
    50487 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    50487 (PLA2G3)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    50487 (PLA2G3)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    50487 (PLA2G3)
  Digestive system
   04972 Pancreatic secretion
    50487 (PLA2G3)
   04975 Fat digestion and absorption
    50487 (PLA2G3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     50487 (PLA2G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.2
AA seq 509 aa AA seqDB search
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcaggcagggctgtttgggatgctgggcttcctgggggtggccctggggggc
tcccctgccctccgctggtacaggacctcctgccacttgaccaaggccgtccctggcaac
ccactggggtacctgagcttcctggccaaggatgctcagggactggccctgatccatgcc
cgctgggatgcgcataggaggctgcagtcatgtagctgggaggatgagccggagctcacc
gcagcctacggtgctctctgtgctcatgagactgcctggggctccttcatccacaccccc
ggacccgagctgcagagagcactggccactcttcagagtcagtgggaggcatgccgagcg
cttgaggagagtccagcaggggccaggaagaagcgagcagcagggcagagtggagtccct
ggtggagggcaccagcgagagaagagaggatggaccatgcctggcacactgtggtgtgga
gttggagattctgctgggaactcctcggagctgggggtcttccagggacctgatctctgt
tgccgggaacatgaccgctgcccacagaacatctcacccttgcagtacaactatggcatc
cgaaactaccgattccacaccatctcccactgtgactgtgacaccaggtttcagcaatgc
ctacagaatcagcacgactccatctcggacatcgtgggcgtggccttcttcaacgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcgtggtactggtggggc
gggtgtaggatgtacggcacagtgcccctcgctcgcctgcagcccaggaccttctacaat
gcctcctggagctcccgggccacctccccaactcccagctcccggagcccagcccctccc
aagcctcgacagaagcagcaccttcggaaggggccaccacatcagaaagggtccaagcgc
cccagcaaagccaacaccacagccctccaggaccctatggtctctcccaggcttgatgtg
gcccccacaggcctccagggcccacagggtggcctaaaacctcagggtgcccgctgggtc
tgccgcagcttccgccgccacctggaccagtgtgagcaccagattgggccccgggaaatc
gagttccagctgctcaacagcgcccaagagcccctcttccactgcaactgcacgcgccgt
ctggcacgcttcctgaggctccacagcccacccgaggttaccaacatgctttgggagctg
ctgggcacaacctgcttcaagctggcccctccactggactgtgtggaaggcaaaaactgt
tccagagaccctagggccatcagggtgtcagcccggcacttgcggaggcttcagcagagg
cgacaccagctccaggataaaggcacagatgagaggcagccatggccttcagagcccctg
agaggccccatgtcattctacaaccagtgcctgcagctaacccaggcagccaggagaccc
gacaggcagcagaagtcctggagccagtga

DBGET integrated database retrieval system