KEGG   Homo sapiens (human): 50487Help
Entry
50487             CDS       T01001                                 

Gene name
PLA2G3, GIII-SPLA2, SPLA2III
Definition
phospholipase A2, group III (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hsa00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hsa00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.2
AA seq 509 aa AA seqDB search
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcaggcagggctgtttgggatgctgggcttcctgggggtggccctggggggc
tcccctgccctccgctggtacaggacctcctgccacttgaccaaggccgtccctggcaac
ccactggggtacctgagcttcctggccaaggatgctcagggactggccctgatccatgcc
cgctgggatgcgcataggaggctgcagtcatgtagctgggaggatgagccggagctcacc
gcagcctacggtgctctctgtgctcatgagactgcctggggctccttcatccacaccccc
ggacccgagctgcagagagcactggccactcttcagagtcagtgggaggcatgccgagcg
cttgaggagagtccagcaggggccaggaagaagcgagcagcagggcagagtggagtccct
ggtggagggcaccagcgagagaagagaggatggaccatgcctggcacactgtggtgtgga
gttggagattctgctgggaactcctcggagctgggggtcttccagggacctgatctctgt
tgccgggaacatgaccgctgcccacagaacatctcacccttgcagtacaactatggcatc
cgaaactaccgattccacaccatctcccactgtgactgtgacaccaggtttcagcaatgc
ctacagaatcagcacgactccatctcggacatcgtgggcgtggccttcttcaacgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcgtggtactggtggggc
gggtgtaggatgtacggcacagtgcccctcgctcgcctgcagcccaggaccttctacaat
gcctcctggagctcccgggccacctccccaactcccagctcccggagcccagcccctccc
aagcctcgacagaagcagcaccttcggaaggggccaccacatcagaaagggtccaagcgc
cccagcaaagccaacaccacagccctccaggaccctatggtctctcccaggcttgatgtg
gcccccacaggcctccagggcccacagggtggcctaaaacctcagggtgcccgctgggtc
tgccgcagcttccgccgccacctggaccagtgtgagcaccagattgggccccgggaaatc
gagttccagctgctcaacagcgcccaagagcccctcttccactgcaactgcacgcgccgt
ctggcacgcttcctgaggctccacagcccacccgaggttaccaacatgctttgggagctg
ctgggcacaacctgcttcaagctggcccctccactggactgtgtggaaggcaaaaactgt
tccagagaccctagggccatcagggtgtcagcccggcacttgcggaggcttcagcagagg
cgacaccagctccaggataaaggcacagatgagaggcagccatggccttcagagcccctg
agaggccccatgtcattctacaaccagtgcctgcagctaacccaggcagccaggagaccc
gacaggcagcagaagtcctggagccagtga

DBGET integrated database retrieval system