KEGG   Homo sapiens (human): 50508Help
Entry
50508             CDS       T01001                                 

Gene name
NOX3, GP91-3, MOX-2
Definition
NADPH oxidase 3
Orthology
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    50508 (NOX3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    50508 (NOX3)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    50508 (NOX3)
  Development
   04380 Osteoclast differentiation
    50508 (NOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.3
AA seq 568 aa AA seqDB search
MMGCWILNEGLSTILVLSWLGINFYLFIDTFYWYEEEESFHYTRVILGSTLAWARASALC
LNFNCMLILIPVSRNLISFIRGTSICCRGPWRRQLDKNLRFHKLVAYGIAVNATIHIVAH
FFNLERYHWSQSEEAQGLLAALSKLGNTPNESYLNPVRTFPTNTTTELLRTIAGVTGLVI
SLALVLIMTSSTEFIRQASYELFWYTHHVFIVFFLSLAIHGTGRIVRGQTQDSLSLHNIT
FCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVS
HPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWT
AALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTDVFHYPVCVCVAAGIGVTPFAALLKS
IWYKCSEAQTPLKLSKVYFYWICRDARAFEWFADLLLSLETRMSEQGKTHFLSYHIFLTG
WDENQALHIALHWDENTDVITGLKQKTFYGRPNWNNEFKQIAYNHPSSSIGVFFCGPKAL
SRTLQKMCHLYSSADPRGVHFYYNKESF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgatggggtgctggattttgaatgagggtctctccaccatattagtactctcatggctg
ggaataaatttttatctgtttattgacacgttctactggtatgaagaggaggagtctttc
cattacacacgagttattttgggttcaacactggcttgggcacgagcatccgcactgtgc
ctgaattttaactgcatgctaattctaatacctgtcagtcgaaaccttatttcattcata
agaggaacaagtatttgctgcagaggaccgtggaggaggcaattagacaaaaacctcaga
tttcacaaactggtcgcctatgggatagctgttaatgcaaccatccacatcgtggcgcat
ttcttcaacctggaacgctaccactggagccagtccgaggaggcccagggacttctggcc
gcactttccaagctgggcaacacccctaacgagagctacctcaaccctgtccggaccttc
cccacaaacacaaccactgaattgctaaggacaatagcaggcgtcaccggtctggtgatc
tctctggctttagtcttgatcatgacctcgtcaactgagttcatcagacaggcctcctat
gagttgttctggtacacacaccatgttttcatcgtcttctttctcagcctggccatccat
gggacgggtcggattgttcgaggccaaacccaagacagtctctctctgcacaacatcacc
ttctgtagagaccgctatgcagaatggcagacagtggcccaatgccccgtgcctcaattt
tctggcaaggaaccctcggcttggaaatggattttaggccctgtggtcttgtatgcatgt
gaaagaataattaggttctggcgatttcaacaagaagttgtcattaccaaggtggtaagc
cacccctctggagtcctggaacttcacatgaaaaagcgtggctttaaaatggcgccaggg
cagtacatcttggtgcagtgcccagccatatcttcgctggagtggcaccccttcaccctt
acctctgccccccaggaggactttttcagcgtgcacatccgggcagcaggagactggaca
gcagcgctactggaggcctttggggcagagggacaggccctccaggagccctggagcctg
ccaaggctggcagtggacgggccctttggaactgccctgacagatgtatttcactaccca
gtgtgtgtgtgcgttgccgcggggatcggagtcactcccttcgctgctcttctgaaatct
atatggtacaaatgcagtgaggcacagaccccactgaagctgagcaaggtgtatttctac
tggatttgccgggatgcaagagcttttgagtggtttgctgatctcttactctccctggaa
acacggatgagtgagcaggggaaaactcactttctgagttatcatatatttcttaccggc
tgggatgaaaatcaggctcttcacatagctttacactgggacgaaaatactgacgtgatt
acaggcttaaagcagaagaccttctatgggaggcccaactggaacaatgagttcaagcag
attgcctacaatcaccccagcagcagtattggcgtgttcttctgtggacctaaagctctc
tcgaggacacttcaaaagatgtgccacttgtattcatcagctgaccccagaggtgttcat
ttctattacaacaaggagagcttctag

DBGET integrated database retrieval system