KEGG   Homo sapiens (human): 50604Help
Entry
50604             CDS       T01001                                 

Gene name
IL20, IL-20, IL10D, ZCYTO10
Definition
interleukin 20
Orthology
K05444  
interleukin 19/20/24
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 176 aa AA seqDB search
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctctagtcttgccttcagccttctctctgctgcgttttatctcctatggact
ccttccactggactgaagacactcaatttgggaagctgtgtgatcgccacaaaccttcag
gaaatacgaaatggattttctgagatacggggcagtgtgcaagccaaagatggaaacatt
gacatcagaatcttaaggaggactgagtctttgcaagacacaaagcctgcgaatcgatgc
tgcctcctgcgccatttgctaagactctatctggacagggtatttaaaaactaccagacc
cctgaccattatactctccggaagatcagcagcctcgccaattcctttcttaccatcaag
aaggacctccggctctgtcatgcccacatgacatgccattgtggggaggaagcaatgaag
aaatacagccagattctgagtcactttgaaaagctggaacctcaggcagcagttgtgaag
gctttgggggaactagacattcttctgcaatggatggaggagacagaatag

DBGET integrated database retrieval system