KEGG   Homo sapiens (human): 5062Help
Entry
5062              CDS       T01001                                 

Gene name
PAK2, PAK65, PAKgamma
Definition
p21 protein (Cdc42/Rac)-activated kinase 2 (EC:2.7.11.1)
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5062 (PAK2)
   04010 MAPK signaling pathway
    5062 (PAK2)
   04012 ErbB signaling pathway
    5062 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5062 (PAK2)
  Cellular commiunity
   04510 Focal adhesion
    5062 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5062 (PAK2)
  Development
   04360 Axon guidance
    5062 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5062 (PAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5062 (PAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   5062 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q29
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagataagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaagagaaaaagcccaggcataaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacccgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcatacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcacatgttgatggtgctgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactatcgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcactgggacaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaactgatcattaacgagattctggtgatgaaagaa
ttgaaaaatcccaacatcgttaactttttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggggggtcactcactgatgtggtaacagaaacgtgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtacttttgggaatggaagga
tctgttaagctcactgactttggtttctgtgcccagatcacccctgagcagagcaaacgc
agtaccatggtcggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcctg
aaactggccaaaccgttatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

DBGET integrated database retrieval system