KEGG   Homo sapiens (human): 5071Help
Entry
5071              CDS       T01001                                 

Gene name
PRKN, AR-JP, LPRS2, PARK2, PDJ
Definition
(RefSeq) parkin RBR E3 ubiquitin protein ligase
  KO
K04556  
parkin [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Mitophagy - animal
Protein processing in endoplasmic reticulum
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
H00344  
Leprosy
H01600  
Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5071 (PRKN)
   04120 Ubiquitin mediated proteolysis
    5071 (PRKN)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    5071 (PRKN)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    5071 (PRKN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     5071 (PRKN)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    5071 (PRKN)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    5071 (PRKN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O60260(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6q26
AA seq 465 aa AA seqDB search
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagccatggtttcccagtggaggtcgattctgac
accagcatcttccagctcaaggaggtggttgctaagcgacagggggttccggctgaccag
ttgcgtgtgattttcgcagggaaggagctgaggaatgactggactgtgcagaattgtgac
ctggatcagcagagcattgttcacattgtgcagagaccgtggagaaaaggtcaagaaatg
aatgcaactggaggcgacgaccccagaaacgcggcgggaggctgtgagcgggagccccag
agcttgactcgggtggacctcagcagctcagtcctcccaggagactctgtggggctggct
gtcattctgcacactgacagcaggaaggactcaccaccagctggaagtccagcaggtaga
tcaatctacaacagcttttatgtgtattgcaaaggcccctgtcaaagagtgcagccggga
aaactcagggtacagtgcagcacctgcaggcaggcaacgctcaccttgacccagggtcca
tcttgctgggatgatgttttaattccaaaccggatgagtggtgaatgccaatccccacac
tgccctgggactagtgcagaatttttctttaaatgtggagcacaccccacctctgacaag
gaaacatcagtagctttgcacctgatcgcaacaaatagtcggaacatcacttgcattacg
tgcacagacgtcaggagccccgtcctggttttccagtgcaactcccgccacgtgatttgc
ttagactgtttccacttatactgtgtgacaagactcaatgatcggcagtttgttcacgac
cctcaacttggctactccctgccttgtgtggctggctgtcccaactccttgattaaagag
ctccatcacttcaggattctgggagaagagcagtacaaccggtaccagcagtatggtgca
gaggagtgtgtcctgcagatggggggcgtgttatgcccccgccctggctgtggagcgggg
ctgctgccggagcctgaccagaggaaagtcacctgcgaagggggcaatggcctgggctgt
gggtttgccttctgccgggaatgtaaagaagcgtaccatgaaggggagtgcagtgccgta
tttgaagcctcaggaacaactactcaggcctacagagtcgatgaaagagccgccgagcag
gctcgttgggaagcagcctccaaagaaaccatcaagaaaaccaccaagccctgtccccgc
tgccatgtaccagtggaaaaaaatggaggctgcatgcacatgaagtgtccgcagccccag
tgcaggctcgagtggtgctggaactgtggctgcgagtggaaccgcgtctgcatgggggac
cactggttcgacgtgtag

DBGET integrated database retrieval system