KEGG   Homo sapiens (human): 50846Help
Entry
50846             CDS       T01001                                 

Gene name
DHH, GDXYM, HHG-3, SRXY7
Definition
desert hedgehog
Orthology
K11990  
desert hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
Hedgehog signaling pathway
Module
Hedgehog signaling
Disease
H00607  
46,XY disorders of sex development (Disorders of gonadal development)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    50846 (DHH)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C46: hedgehog family
   50846 (DHH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.1
AA seq 396 aa AA seqDB search
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctgaccaatctactgcccctgtgctgcttggcacttctggcgctgccagcc
cagagctgcgggccgggccgggggccggttggccggcgccgctatgcgcgcaagcagctc
gtgccgctactctacaagcaatttgtgcccggcgtgccagagcggaccctgggcgccagt
gggccagcggaggggagggtggcaaggggctccgagcgcttccgggacctcgtgcccaac
tacaaccccgacatcatcttcaaggatgaggagaacagtggagccgaccgcctgatgacc
gagcgttgtaaggagcgggtgaacgctttggccattgccgtgatgaacatgtggcccgga
gtgcgcctacgagtgactgagggctgggacgaggacggccaccacgctcaggattcactc
cactacgaaggccgtgctttggacatcactacgtctgaccgcgaccgcaacaagtatggg
ttgctggcgcgcctcgcagtggaagccggcttcgactgggtctactacgagtcccgcaac
cacgtccacgtgtcggtcaaagctgataactcactggcggtccgggcgggcggctgcttt
ccgggaaatgcaactgtgcgcctgtggagcggcgagcggaaagggctgcgggaactgcac
cgcggagactgggttttggcggccgatgcgtcaggccgggtggtgcccacgccggtgctg
ctcttcctggaccgggacttgcagcgccgggcttcatttgtggctgtggagaccgagtgg
cctccacgcaaactgttgctcacgccctggcacctggtgtttgccgctcgagggccggcg
cccgcgccaggcgactttgcaccggtgttcgcgcgccggctacgcgctggggactcggtg
ctggcgcccggcggggatgcgcttcggccagcgcgcgtggcccgtgtggcgcgggaggaa
gccgtgggcgtgttcgcgccgctcaccgcgcacgggacgctgctggtgaacgatgtcctg
gcctcttgctacgcggttctggagagtcaccagtgggcgcaccgcgcttttgcccccttg
agactgctgcacgcgctaggggcgctgctccccggcggggccgtccagccgactggcatg
cattggtactctcggctcctctaccgcttagcggaggagctactgggctga

DBGET integrated database retrieval system