KEGG   Homo sapiens (human): 50940Help
Entry
50940             CDS       T01001                                 

Gene name
PDE11A, PPNAD2
Definition
(RefSeq) phosphodiesterase 11A
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04934  Cushing's syndrome
hsa05032  Morphine addiction
Disease
H00260  Pigmented micronodular adrenocortical disease (PPNAD)
H01431  Cushing's syndrome
H02049  Bilateral macronodular adrenal hyperplasia (BMAH)
Drug target
Aminophylline (DG01062): D00227 D05429
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Papaverine (DG00043): D02218 D07425 D07439
Propentofylline: D01630
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    50940 (PDE11A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    50940 (PDE11A)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    50940 (PDE11A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     50940 (PDE11A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     50940 (PDE11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD PET10
Motif
Other DBs
NCBI-GeneID: 50940
NCBI-ProteinID: NP_058649
OMIM: 604961
HGNC: 8773
Ensembl: ENSG00000128655 ENSG00000284741
Vega: OTTHUMG00000154188
Pharos: Q9HCR9(Tchem)
UniProt: Q9HCR9
Position
2q31.2
AA seq 933 aa AA seqDB search
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcccgcctggactttggggaggtggaaactttcctggacaggcacccagag
ttgtttgaagattacttgatgcggaaggggaagcaggagatggttgaaaagtggctgcag
aggcacagtcagggtcagggggctttaggtccaaggccctctttggctggtaccagcagc
ttggctcacagcacctgcagaggtggcagcagcgttggtggtggcactggaccaaatggc
tctgcccacagccagccccttcccggtggcggggactgtggtggggttcccttgagtccc
agctgggccggtggcagcaggggcgatgggaacctgcagcggagagcttctcagaaagag
ctaaggaagagttttgcccgctccaaggccatccacgtgaacaggacctacgatgaacag
gtgacctcccgggctcaggaacccctgagtagtgtacgacggagggcacttctccggaag
gcaagctccctgccccccaccacagcccatattctcagtgcgctgctggaatcgagagtg
aatctgcctcggtatccccctacagccatcgactacaagtgccatctgaaaaagcataat
gagcgtcagttctttctggaattggtcaaagatatctccaatgaccttgacctcaccagc
ctgagctacaagattctcatctttgtctgccttatggtggatgctgaccgctgctctctt
ttcctggtggaaggggcagctgctggcaagaagaccttggtctccaaattctttgatgtg
catgcaggaacacctctgctgccttgcagcagcacagagaactcaaatgaggtgcaggtc
ccctggggcaaaggtatcattggctatgtcggggagcatggagaaacggtcaacattcct
gatgcctaccaggatcgacgattcaatgatgaaatcgacaagctaactggatacaagaca
aaatcattattgtgcatgcctatccgaagcagtgatggtgagattattggtgtggcccaa
gcgataaataagattcctgaaggagctccatttactgaagatgatgaaaaagttatgcag
atgtatcttccattttgtggaatcgccatatctaacgctcagctctttgctgcctcaagg
aaagaatatgaaagaagcagagctttgctagaggtggttaatgacctctttgaagaacag
actgacctggagaaaattgtcaagaaaataatgcatcgggcccaaactctgctgaaatgt
gaacgctgttctgttttactcctagaggacatcgaatcaccagtggtgaaatttaccaaa
tcctttgaattgatgtccccaaagtgcagtgctgatgctgagaacagtttcaaagaaagc
atggagaaatcatcatactccgactggctaataaataacagcattgctgagctggttgct
tcaacaggccttccagtgaacatcagtgatgcctaccaggatccgcgctttgatgcagag
gcagaccagatatctggttttcacataagatctgttctttgtgtccctatttggaatagc
aaccaccaaataattggagtggctcaagtgttaaacagacttgatgggaaaccttttgat
gatgcagatcaacgactttttgaggcttttgtcatcttttgtggacttggcatcaacaac
acaattatgtatgatcaagtgaagaagtcctgggccaagcagtctgtggctcttgatgtg
ctatcataccatgcaacatgttcaaaagctgaagttgacaagtttaaggcagccaacatc
cctctggtgtcagaacttgccatcgatgacattcattttgatgacttttctctcgacgtt
gatgccatgatcacagctgctctccggatgttcatggagctggggatggtacagaaattt
aaaattgactatgagacactgtgtaggtggcttttgacagtgaggaaaaactatcggatg
gttctataccacaactggagacatgccttcaacgtgtgtcagctgatgttcgcgatgtta
accactgctgggtttcaagacattctgaccgaggtggaaattttagcggtgattgtggga
tgcctgtgtcatgacctcgaccacaggggaaccaacaatgccttccaagctaagagtggc
tctgccctggcccaactctatggaacctctgctaccttggagcatcaccatttcaaccac
gccgtgatgatccttcaaagtgagggtcacaatatctttgctaacctgtcctccaaggaa
tatagtgaccttatgcagcttttgaagcagtcaatattggcaacagacctcacgctgtac
tttgagaggagaactgaattctttgaacttgtcagtaaaggagaatacgattggaacatc
aaaaaccatcgtgatatatttcgatcaatgttaatgacagcctgtgaccttggagccgtg
accaaaccgtgggagatctccagacaggtggcagaacttgtaaccagtgagttcttcgaa
caaggagatcgggagagattagagctcaaactcactccttcagcaatttttgatcggaac
cggaaggatgaactgcctcggttgcaactggagtggattgatagcatctgcatgcctttg
tatcaggcactggtgaaggtcaacgtgaaactgaagccgatgctagattcagtagctaca
aacagaagtaagtgggaagagctacaccaaaaacgactgctggcctcaactgcctcatcc
tcccctgccagtgttatggtagccaaggaagacaggaactaa

DBGET integrated database retrieval system