KEGG   Homo sapiens (human): 50940Help
Entry
50940             CDS       T01001                                 

Gene name
PDE11A, PPNAD2
Definition
(RefSeq) phosphodiesterase 11A
  KO
K13298  
dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Morphine addiction
Disease
H00260  
Pigmented micronodular adrenocortical disease (PPNAD)
Drug target
Aminophylline (DG01062): 
Bucladesine (DG00230): 
Choline theophyllinate: 
Diprophylline: 
Flavoxate (DG00477): 
Moxaverine (DG00045): 
Papaverine (DG00043): 
Propentofylline: 
Proxyphylline: 
Theophylline (DG01061): 
Tibenelast sodium: 
Trapidil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    50940 (PDE11A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    50940 (PDE11A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     50940 (PDE11A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     50940 (PDE11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9HCR9(Tchem)
UniProt: 
Position
2q31.2
AA seq 933 aa AA seqDB search
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcccgcctggactttggggaggtggaaactttcctggacaggcacccagag
ttgtttgaagattacttgatgcggaaggggaagcaggagatggttgaaaagtggctgcag
aggcacagtcagggtcagggggctttaggtccaaggccctctttggctggtaccagcagc
ttggctcacagcacctgcagaggtggcagcagcgttggtggtggcactggaccaaatggc
tctgcccacagccagccccttcccggtggcggggactgtggtggggttcccttgagtccc
agctgggccggtggcagcaggggcgatgggaacctgcagcggagagcttctcagaaagag
ctaaggaagagttttgcccgctccaaggccatccacgtgaacaggacctacgatgaacag
gtgacctcccgggctcaggaacccctgagtagtgtacgacggagggcacttctccggaag
gcaagctccctgccccccaccacagcccatattctcagtgcgctgctggaatcgagagtg
aatctgcctcggtatccccctacagccatcgactacaagtgccatctgaaaaagcataat
gagcgtcagttctttctggaattggtcaaagatatctccaatgaccttgacctcaccagc
ctgagctacaagattctcatctttgtctgccttatggtggatgctgaccgctgctctctt
ttcctggtggaaggggcagctgctggcaagaagaccttggtctccaaattctttgatgtg
catgcaggaacacctctgctgccttgcagcagcacagagaactcaaatgaggtgcaggtc
ccctggggcaaaggtatcattggctatgtcggggagcatggagaaacggtcaacattcct
gatgcctaccaggatcgacgattcaatgatgaaatcgacaagctaactggatacaagaca
aaatcattattgtgcatgcctatccgaagcagtgatggtgagattattggtgtggcccaa
gcgataaataagattcctgaaggagctccatttactgaagatgatgaaaaagttatgcag
atgtatcttccattttgtggaatcgccatatctaacgctcagctctttgctgcctcaagg
aaagaatatgaaagaagcagagctttgctagaggtggttaatgacctctttgaagaacag
actgacctggagaaaattgtcaagaaaataatgcatcgggcccaaactctgctgaaatgt
gaacgctgttctgttttactcctagaggacatcgaatcaccagtggtgaaatttaccaaa
tcctttgaattgatgtccccaaagtgcagtgctgatgctgagaacagtttcaaagaaagc
atggagaaatcatcatactccgactggctaataaataacagcattgctgagctggttgct
tcaacaggccttccagtgaacatcagtgatgcctaccaggatccgcgctttgatgcagag
gcagaccagatatctggttttcacataagatctgttctttgtgtccctatttggaatagc
aaccaccaaataattggagtggctcaagtgttaaacagacttgatgggaaaccttttgat
gatgcagatcaacgactttttgaggcttttgtcatcttttgtggacttggcatcaacaac
acaattatgtatgatcaagtgaagaagtcctgggccaagcagtctgtggctcttgatgtg
ctatcataccatgcaacatgttcaaaagctgaagttgacaagtttaaggcagccaacatc
cctctggtgtcagaacttgccatcgatgacattcattttgatgacttttctctcgacgtt
gatgccatgatcacagctgctctccggatgttcatggagctggggatggtacagaaattt
aaaattgactatgagacactgtgtaggtggcttttgacagtgaggaaaaactatcggatg
gttctataccacaactggagacatgccttcaacgtgtgtcagctgatgttcgcgatgtta
accactgctgggtttcaagacattctgaccgaggtggaaattttagcggtgattgtggga
tgcctgtgtcatgacctcgaccacaggggaaccaacaatgccttccaagctaagagtggc
tctgccctggcccaactctatggaacctctgctaccttggagcatcaccatttcaaccac
gccgtgatgatccttcaaagtgagggtcacaatatctttgctaacctgtcctccaaggaa
tatagtgaccttatgcagcttttgaagcagtcaatattggcaacagacctcacgctgtac
tttgagaggagaactgaattctttgaacttgtcagtaaaggagaatacgattggaacatc
aaaaaccatcgtgatatatttcgatcaatgttaatgacagcctgtgaccttggagccgtg
accaaaccgtgggagatctccagacaggtggcagaacttgtaaccagtgagttcttcgaa
caaggagatcgggagagattagagctcaaactcactccttcagcaatttttgatcggaac
cggaaggatgaactgcctcggttgcaactggagtggattgatagcatctgcatgcctttg
tatcaggcactggtgaaggtcaacgtgaaactgaagccgatgctagattcagtagctaca
aacagaagtaagtgggaagagctacaccaaaaacgactgctggcctcaactgcctcatcc
tcccctgccagtgttatggtagccaaggaagacaggaactaa

DBGET integrated database retrieval system