KEGG   Homo sapiens (human): 51032Help
Entry
51032             CDS       T01001                                 

Gene name
CELA2B, ELA2B
Definition
chymotrypsin-like elastase family, member 2B (EC:3.4.21.71)
Orthology
K01346  
pancreatic elastase II [EC:3.4.21.71]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.21
AA seq 269 aa AA seqDB search
MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGG
SLIANSWVLTAAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGRLLV
VDYATCSSSGWWGSTVKTNMICAGGDGVICTCNGDSGGPLNCQASDGRWEVHGIGSLTSV
LGCNYYYKPSIFTRVSNYNDWINSVIANN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgattaggaccctgctgctgtccactttggtggctggagccctcagttgtggggtctcc
acttacgcgcctgatatgtctaggatgcttggaggtgaagaagcgaggcccaacagctgg
ccctggcaggtctccctgcagtacagctccaatggccagtggtaccacacctgcggaggg
tccctgatagccaacagctgggtcctgacggctgcccactgcatcagctcctccgggatc
taccgcgtgatgctgggccagcataacctctacgttgcagagtccggctcgctggccgtc
agtgtctctaagattgtggtgcacaaggactggaactccgaccaggtctccaaagggaac
gacattgccctgctcaaactggctaaccccgtctccctcaccgacaagatccagctggcc
tgcctccctcctgccggcaccattctacccaacaactacccctgctacgtcacgggctgg
ggaaggctgcagaccaacggggctctccctgatgacctgaagcagggccggttgctggtt
gtggactatgccacctgctccagctctggctggtggggcagcaccgtgaagacgaatatg
atctgtgctgggggtgatggcgtgatatgcacctgcaacggagactccggtgggccgctg
aactgtcaggcatctgacggccggtgggaggtgcatggcatcggcagcctcacgtcggtc
cttggttgcaactactactacaagccctccatcttcacgcgggtctccaactacaacgac
tggatcaattcggtgattgcaaataactaa

DBGET integrated database retrieval system