KEGG   Homo sapiens (human): 5105Help
Entry
5105              CDS       T01001                                 

Gene name
PCK1, PCKDC, PEPCK-C, PEPCK1, PEPCKC
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 1
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04964  Proximal tubule bicarbonate reclamation
Module
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5105 (PCK1)
   00020 Citrate cycle (TCA cycle)
    5105 (PCK1)
   00620 Pyruvate metabolism
    5105 (PCK1)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5105 (PCK1)
   04151 PI3K-Akt signaling pathway
    5105 (PCK1)
   04152 AMPK signaling pathway
    5105 (PCK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5105 (PCK1)
   04922 Glucagon signaling pathway
    5105 (PCK1)
   04920 Adipocytokine signaling pathway
    5105 (PCK1)
   03320 PPAR signaling pathway
    5105 (PCK1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    5105 (PCK1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5105 (PCK1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     5105 (PCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_C PEPCK_N
Motif
Other DBs
NCBI-GeneID: 5105
NCBI-ProteinID: NP_002582
OMIM: 614168
HGNC: 8724
Ensembl: ENSG00000124253
Vega: OTTHUMG00000032825
Pharos: P35558(Tchem)
UniProt: P35558
Structure
PDB: 

Jmol
Position
20q13.31
AA seq 622 aa AA seqDB search
MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQM
EEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEAVGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQV
NADLPCEIEREILALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagctgcaaaacggcctgaacctctcggccaaagttgtccagggaagcctg
gacagcctaccccaggcagtgagggagtttctcgagaataacgctgagctgtgtcagcct
gatcacatccacatctgtgacggctctgaggaggagaatgggcggcttctgggccagatg
gaggaagagggcatcctcaggcggctgaagaagtatgacaactgctggttggctctcact
gaccccagggatgtggccaggatcgaaagcaagacggttatcgtcacccaagagcaaaga
gacacagtgcccatccccaaaacaggcctcagccagctcggtcgctggatgtcagaggag
gattttgagaaagcgttcaatgccaggttcccagggtgcatgaaaggtcgcaccatgtac
gtcatcccattcagcatggggccgctgggctcgcctctgtcaaagatcggcatcgagctg
acggattcaccctacgtggtggccagcatgcggatcatgacgcggatgggcacgcccgtc
ctggaagcagtgggcgatggggagtttgtcaaatgcctccattctgtggggtgccctctg
cctttacaaaagcctttggtcaacaactggccctgcaacccggagctgacgctcatcgcc
cacctgcctgaccgcagagagatcatctcctttggcagtgggtacggcgggaactcgctg
ctcgggaagaagtgctttgctctcaggatggccagccggctggccaaggaggaagggtgg
ctggcagagcacatgctgattctgggtataaccaaccctgagggtgagaagaagtacctg
gcggccgcatttcccagcgcctgcgggaagaccaacctggccatgatgaaccccagcctc
cccgggtggaaggttgagtgcgtcggggatgacattgcctggatgaagtttgacgcacaa
ggtcatttaagggccatcaacccagaaaatggctttttcggtgtcgctcctgggacttca
gtgaagaccaaccccaatgccatcaagaccatccagaagaacacaatctttaccaatgtg
gccgagaccagcgacgggggcgtttactgggaaggcattgatgagccgctagcttcaggt
gtcaccatcacgtcctggaagaataaggagtggagctcagaggatggggaaccttgtgcc
caccccaactcgaggttctgcacccctgccagccagtgccccatcattgatgctgcctgg
gagtctccggaaggtgttcccattgaaggcattatctttggaggccgtagacctgctggt
gtccctctagtctatgaagctctcagctggcaacatggagtctttgtgggggcggccatg
agatcagaggccacagcggctgcagaacataaaggcaaaatcatcatgcatgaccccttt
gccatgcggcccttctttggctacaacttcggcaaatacctggcccactggcttagcatg
gcccagcacccagcagccaaactgcccaagatcttccatgtcaactggttccggaaggac
aaggaaggcaaattcctctggccaggctttggagagaactccagggtgctggagtggatg
ttcaaccggatcgatggaaaagccagcaccaagctcacgcccataggctacatccccaag
gaggatgccctgaacctgaaaggcctggggcacatcaacatgatggagcttttcagcatc
tccaaggaattctgggagaaggaggtggaagacatcgagaagtatctggaggatcaagtc
aatgccgacctcccctgtgaaatcgagagagagatccttgccttgaagcaaagaataagc
cagatgtaa

DBGET integrated database retrieval system