KEGG   Homo sapiens (human): 5105Help
Entry
5105              CDS       T01001                                 

Gene name
PCK1, PEPCK-C, PEPCK1, PEPCKC
Definition
phosphoenolpyruvate carboxykinase 1 (soluble) (EC:4.1.1.32)
Orthology
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
PPAR signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Proximal tubule bicarbonate reclamation
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.31
AA seq 622 aa AA seqDB search
MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQM
EEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEAVGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQV
NADLPCEIEREILALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagctgcaaaacggcctgaacctctcggccaaagttgtccagggaagcctg
gacagcctaccccaggcagtgagggagtttctcgagaataacgctgagctgtgtcagcct
gatcacatccacatctgtgacggctctgaggaggagaatgggcggcttctgggccagatg
gaggaagagggcatcctcaggcggctgaagaagtatgacaactgctggttggctctcact
gaccccagggatgtggccaggatcgaaagcaagacggttatcgtcacccaagagcaaaga
gacacagtgcccatccccaaaacaggcctcagccagctcggtcgctggatgtcagaggag
gattttgagaaagcgttcaatgccaggttcccagggtgcatgaaaggtcgcaccatgtac
gtcatcccattcagcatggggccgctgggctcgcctctgtcaaagatcggcatcgagctg
acggattcaccctacgtggtggccagcatgcggatcatgacgcggatgggcacgcccgtc
ctggaagcagtgggcgatggggagtttgtcaaatgcctccattctgtggggtgccctctg
cctttacaaaagcctttggtcaacaactggccctgcaacccggagctgacgctcatcgcc
cacctgcctgaccgcagagagatcatctcctttggcagtgggtacggcgggaactcgctg
ctcgggaagaagtgctttgctctcaggatggccagccggctggccaaggaggaagggtgg
ctggcagagcacatgctgattctgggtataaccaaccctgagggtgagaagaagtacctg
gcggccgcatttcccagcgcctgcgggaagaccaacctggccatgatgaaccccagcctc
cccgggtggaaggttgagtgcgtcggggatgacattgcctggatgaagtttgacgcacaa
ggtcatttaagggccatcaacccagaaaatggctttttcggtgtcgctcctgggacttca
gtgaagaccaaccccaatgccatcaagaccatccagaagaacacaatctttaccaatgtg
gccgagaccagcgacgggggcgtttactgggaaggcattgatgagccgctagcttcaggt
gtcaccatcacgtcctggaagaataaggagtggagctcagaggatggggaaccttgtgcc
caccccaactcgaggttctgcacccctgccagccagtgccccatcattgatgctgcctgg
gagtctccggaaggtgttcccattgaaggcattatctttggaggccgtagacctgctggt
gtccctctagtctatgaagctctcagctggcaacatggagtctttgtgggggcggccatg
agatcagaggccacagcggctgcagaacataaaggcaaaatcatcatgcatgaccccttt
gccatgcggcccttctttggctacaacttcggcaaatacctggcccactggcttagcatg
gcccagcacccagcagccaaactgcccaagatcttccatgtcaactggttccggaaggac
aaggaaggcaaattcctctggccaggctttggagagaactccagggtgctggagtggatg
ttcaaccggatcgatggaaaagccagcaccaagctcacgcccataggctacatccccaag
gaggatgccctgaacctgaaaggcctggggcacatcaacatgatggagcttttcagcatc
tccaaggaattctgggagaaggaggtggaagacatcgagaagtatctggaggatcaagtc
aatgccgacctcccctgtgaaatcgagagagagatccttgccttgaagcaaagaataagc
cagatgtaa

DBGET integrated database retrieval system