KEGG   Homo sapiens (human): 5105Help
Entry
5105              CDS       T01001                                 

Gene name
PCK1, PEPCK-C, PEPCK1, PEPCKC
Definition
phosphoenolpyruvate carboxykinase 1 (soluble) (EC:4.1.1.32)
Orthology
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
PPAR signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Proximal tubule bicarbonate reclamation
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5105 (PCK1)
   00020 Citrate cycle (TCA cycle)
    5105 (PCK1)
   00620 Pyruvate metabolism
    5105 (PCK1)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5105 (PCK1)
   04151 PI3K-Akt signaling pathway
    5105 (PCK1)
   04152 AMPK signaling pathway
    5105 (PCK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5105 (PCK1)
   04920 Adipocytokine signaling pathway
    5105 (PCK1)
   03320 PPAR signaling pathway
    5105 (PCK1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    5105 (PCK1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     5105 (PCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.31
AA seq 622 aa AA seqDB search
MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQM
EEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEAVGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQV
NADLPCEIEREILALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagctgcaaaacggcctgaacctctcggccaaagttgtccagggaagcctg
gacagcctaccccaggcagtgagggagtttctcgagaataacgctgagctgtgtcagcct
gatcacatccacatctgtgacggctctgaggaggagaatgggcggcttctgggccagatg
gaggaagagggcatcctcaggcggctgaagaagtatgacaactgctggttggctctcact
gaccccagggatgtggccaggatcgaaagcaagacggttatcgtcacccaagagcaaaga
gacacagtgcccatccccaaaacaggcctcagccagctcggtcgctggatgtcagaggag
gattttgagaaagcgttcaatgccaggttcccagggtgcatgaaaggtcgcaccatgtac
gtcatcccattcagcatggggccgctgggctcgcctctgtcaaagatcggcatcgagctg
acggattcaccctacgtggtggccagcatgcggatcatgacgcggatgggcacgcccgtc
ctggaagcagtgggcgatggggagtttgtcaaatgcctccattctgtggggtgccctctg
cctttacaaaagcctttggtcaacaactggccctgcaacccggagctgacgctcatcgcc
cacctgcctgaccgcagagagatcatctcctttggcagtgggtacggcgggaactcgctg
ctcgggaagaagtgctttgctctcaggatggccagccggctggccaaggaggaagggtgg
ctggcagagcacatgctgattctgggtataaccaaccctgagggtgagaagaagtacctg
gcggccgcatttcccagcgcctgcgggaagaccaacctggccatgatgaaccccagcctc
cccgggtggaaggttgagtgcgtcggggatgacattgcctggatgaagtttgacgcacaa
ggtcatttaagggccatcaacccagaaaatggctttttcggtgtcgctcctgggacttca
gtgaagaccaaccccaatgccatcaagaccatccagaagaacacaatctttaccaatgtg
gccgagaccagcgacgggggcgtttactgggaaggcattgatgagccgctagcttcaggt
gtcaccatcacgtcctggaagaataaggagtggagctcagaggatggggaaccttgtgcc
caccccaactcgaggttctgcacccctgccagccagtgccccatcattgatgctgcctgg
gagtctccggaaggtgttcccattgaaggcattatctttggaggccgtagacctgctggt
gtccctctagtctatgaagctctcagctggcaacatggagtctttgtgggggcggccatg
agatcagaggccacagcggctgcagaacataaaggcaaaatcatcatgcatgaccccttt
gccatgcggcccttctttggctacaacttcggcaaatacctggcccactggcttagcatg
gcccagcacccagcagccaaactgcccaagatcttccatgtcaactggttccggaaggac
aaggaaggcaaattcctctggccaggctttggagagaactccagggtgctggagtggatg
ttcaaccggatcgatggaaaagccagcaccaagctcacgcccataggctacatccccaag
gaggatgccctgaacctgaaaggcctggggcacatcaacatgatggagcttttcagcatc
tccaaggaattctgggagaaggaggtggaagacatcgagaagtatctggaggatcaagtc
aatgccgacctcccctgtgaaatcgagagagagatccttgccttgaagcaaagaataagc
cagatgtaa

DBGET integrated database retrieval system