KEGG   Homo sapiens (human): 51079Help
Entry
51079             CDS       T01001                                 

Gene name
NDUFA13, B16.6, CDA016, GRIM-19, GRIM19
Definition
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
Orthology
K11353  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    51079 (NDUFA13)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    51079 (NDUFA13)
   05012 Parkinson's disease
    51079 (NDUFA13)
   05016 Huntington's disease
    51079 (NDUFA13)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51079 (NDUFA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.2
AA seq 144 aa AA seqDB search
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRL
QIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPL
IGELYGLRTTEEALHASHGFMWYT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgac
tacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctggccatagggatt
ggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgccta
caaatcgaggacttcgaggctcgcatcgcgctgttgccactgttacaggcagaaaccgac
cggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggac
gtgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttg
atcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttc
atgtggtacacgtag

DBGET integrated database retrieval system