KEGG   Homo sapiens (human): 5111Help
Entry
5111              CDS       T01001                                 

Gene name
PCNA
Definition
proliferating cell nuclear antigen
Orthology
K04802  
proliferating cell nuclear antigen
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Cell cycle
Hepatitis B
HTLV-I infection
Module
BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    5111 (PCNA)
   03410 Base excision repair
    5111 (PCNA)
   03420 Nucleotide excision repair
    5111 (PCNA)
   03430 Mismatch repair
    5111 (PCNA)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5111 (PCNA)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    5111 (PCNA)
   05161 Hepatitis B
    5111 (PCNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20pter-p12
AA seq 261 aa AA seqDB search
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggcgcgcctggtccagggctccatcctcaagaaggtgttggaggcactcaag
gacctcatcaacgaggcctgctgggatattagctccagcggtgtaaacctgcagagcatg
gactcgtcccacgtctctttggtgcagctcaccctgcggtctgagggcttcgacacctac
cgctgcgaccgcaacctggccatgggcgtgaacctcaccagtatgtccaaaatactaaaa
tgcgccggcaatgaagatatcattacactaagggccgaagataacgcggataccttggcg
ctagtatttgaagcaccaaaccaggagaaagtttcagactatgaaatgaagttgatggat
ttagatgttgaacaacttggaattccagaacaggagtacagctgtgtagtaaagatgcct
tctggtgaatttgcacgtatatgccgagatctcagccatattggagatgctgttgtaatt
tcctgtgcaaaagacggagtgaaattttctgcaagtggagaacttggaaatggaaacatt
aaattgtcacagacaagtaatgtcgataaagaggaggaagctgttaccatagagatgaat
gaaccagttcaactaacttttgcactgaggtacctgaacttctttacaaaagccactcca
ctctcttcaacggtgacactcagtatgtctgcagatgtaccccttgttgtagagtataaa
attgcggatatgggacacttaaaatactacttggctcccaagatcgaggatgaagaagga
tcttag

DBGET integrated database retrieval system