KEGG   Homo sapiens (human): 51119Help
Entry
51119             CDS       T01001                                 

Gene name
SBDS, CGI-97, SDS, SWDS
Definition
(RefSeq) SBDS, ribosome maturation factor
  KO
K14574  
ribosome maturation protein SDO1
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H00101  
Other phagocyte defects
H00439  
Shwachman-Diamond syndrome (SDS)
H00479  
Metaphyseal dysplasias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    51119 (SBDS)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    51119 (SBDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y3A5(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.21
AA seq 250 aa AA seqDB search
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNV
SKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCV
NPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPV
NEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLK
DVEEGDEKFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcttcacccccaccaaccagatccgcctaaccaatgtggccgtggtacggatg
aagcgtgccgggaagcgcttcgaaatcgcctgctacaaaaacaaggtcgtcggctggcgg
agcggcgtggaaaaagacctcgatgaagttctgcagacccactcagtgtttgtaaatgtt
tctaaaggtcaggttgccaaaaaggaagatctcatcagtgcgtttggaacagatgaccaa
actgaaatctgtaagcagattttgactaaaggagaagttcaagtatcagataaagaaaga
cacacacaactggagcagatgtttagggacattgcaactattgtggcagacaaatgtgtg
aatcctgaaacaaagagaccatacaccgtgatccttattgagagagccatgaaggacatc
cactattcggtgaaaaccaacaagagtacaaaacagcaggctttggaagtgataaagcag
ttaaaagagaaaatgaagatagaacgtgctcacatgaggcttcggttcatccttccagtc
aatgaaggcaagaagctgaaagaaaagctcaagccactgatcaaggtcatagaaagtgaa
gattatggccaacagttagaaatcgtatgtctgattgacccgggctgcttccgagaaatt
gatgagctaataaaaaaggaaactaaaggcaaaggttctttggaagtactcaatctgaaa
gatgtagaagaaggagatgagaaatttgaatga

DBGET integrated database retrieval system