KEGG   Homo sapiens (human): 51119Help
Entry
51119             CDS       T01001                                 

Gene name
SBDS, CGI-97, SDS, SWDS
Definition
(RefSeq) SBDS, ribosome assembly guanine nucleotide exchange factor
  KO
K14574  
ribosome maturation protein SDO1
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H00101  
Other phagocyte defects
H00439  
Shwachman-Diamond syndrome (SDS)
H00479  
Metaphyseal dysplasias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    51119 (SBDS)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    51119 (SBDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y3A5(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.21
AA seq 250 aa AA seqDB search
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNV
SKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCV
NPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPV
NEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLK
DVEEGDEKFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcttcacccccaccaaccagatccgcctaaccaatgtggccgtggtacggatg
aagcgtgccgggaagcgcttcgaaatcgcctgctacaaaaacaaggtcgtcggctggcgg
agcggcgtggaaaaagacctcgatgaagttctgcagacccactcagtgtttgtaaatgtt
tctaaaggtcaggttgccaaaaaggaagatctcatcagtgcgtttggaacagatgaccaa
actgaaatctgtaagcagattttgactaaaggagaagttcaagtatcagataaagaaaga
cacacacaactggagcagatgtttagggacattgcaactattgtggcagacaaatgtgtg
aatcctgaaacaaagagaccatacaccgtgatccttattgagagagccatgaaggacatc
cactattcggtgaaaaccaacaagagtacaaaacagcaggctttggaagtgataaagcag
ttaaaagagaaaatgaagatagaacgtgctcacatgaggcttcggttcatccttccagtc
aatgaaggcaagaagctgaaagaaaagctcaagccactgatcaaggtcatagaaagtgaa
gattatggccaacagttagaaatcgtatgtctgattgacccgggctgcttccgagaaatt
gatgagctaataaaaaaggaaactaaaggcaaaggttctttggaagtactcaatctgaaa
gatgtagaagaaggagatgagaaatttgaatga

DBGET integrated database retrieval system