KEGG   Homo sapiens (human): 51128Help
Entry
51128             CDS       T01001                                 

Gene name
SAR1B, ANDD, CMRD, GTBPB, SARA2
Definition
secretion associated, Ras related GTPase 1B
Orthology
K07953  
GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Legionellosis
Module
COPII complex
Disease
H00927  
Chylomicron retention disease (CRD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51128 (SAR1B)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    51128 (SAR1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     51128 (SAR1B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Sar
    51128 (SAR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 198 aa AA seqDB search
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcatatttgattggatttacagtggtttcagcagtgtgctacagtttttagga
ttatataagaaaactggtaaactggtatttcttggattggataatgcaggaaaaacaaca
ttgctacacatgctaaaagatgacagacttggacaacatgtcccaacattacatcccact
tccgaagaactgaccattgctggcatgacgtttacaacttttgatctgggtggacatgtt
caagctcgaagagtgtggaaaaactaccttcctgctatcaatggcattgtatttctggtg
gattgtgcagaccacgaaaggctgttagagtcaaaagaagaacttgattcactaatgaca
gatgaaaccattgctaatgtgcctatactgattcttgggaataagatcgacagacctgaa
gccatcagtgaagagaggttgcgagagatgtttggtttatatggtcagacaacaggaaag
gggagtatatctctgaaagaactgaatgcccgacccttagaagttttcatgtgtagtgtg
ctcaaaagacaaggttacggagaaggcttccgctggatggcacagtacattgattaa

DBGET integrated database retrieval system