KEGG   Homo sapiens (human): 51128Help
Entry
51128             CDS       T01001                                 

Gene name
SAR1B, ANDD, CMRD, GTBPB, SARA2
Definition
SAR1 homolog B (S. cerevisiae)
Orthology
K07953  
GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Legionellosis
Module
COPII complex
Disease
H00927  
Chylomicron retention disease (CRD)
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 198 aa AA seqDB search
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcatatttgattggatttacagtggtttcagcagtgtgctacagtttttagga
ttatataagaaaactggtaaactggtatttcttggattggataatgcaggaaaaacaaca
ttgctacacatgctaaaagatgacagacttggacaacatgtcccaacattacatcccact
tccgaagaactgaccattgctggcatgacgtttacaacttttgatctgggtggacatgtt
caagctcgaagagtgtggaaaaactaccttcctgctatcaatggcattgtatttctggtg
gattgtgcagaccacgaaaggctgttagagtcaaaagaagaacttgattcactaatgaca
gatgaaaccattgctaatgtgcctatactgattcttgggaataagatcgacagacctgaa
gccatcagtgaagagaggttgcgagagatgtttggtttatatggtcagacaacaggaaag
gggagtatatctctgaaagaactgaatgcccgacccttagaagttttcatgtgtagtgtg
ctcaaaagacaaggttacggagaaggcttccgctggatggcacagtacattgattaa

DBGET integrated database retrieval system