KEGG   Homo sapiens (human): 51166Help
Entry
51166             CDS       T01001                                 

Gene name
AADAT, KAT2, KATII
Definition
aminoadipate aminotransferase (EC:2.6.1.7 2.6.1.39)
Orthology
K00825  
kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine biosynthesis
Lysine degradation
Tryptophan metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hsa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hsa00300]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q33
AA seq 429 aa AA seqDB search
MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVE
NGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSG
SQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILS
RWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFL
QFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPS
TFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFL
WIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQV
LAQLIKESL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcacggttcatcacggcagcgagcgcagccagaaacccttctcccatccgg
accatgagtgagaaacgggctgacatattgagcagaggaccaaaatcgatgatctccttg
gctggtggcttaccaaatccaaacatgtttccttttaagactgccgtaatcactgtagaa
aatggaaagaccatccaatttggagaagagatgatgaagagagcacttcagtattctccg
agtgctggaattccagagcttttgtcctggctaaaacagttacaaataaaattgcataat
cctcctaccatccattacccacccagtcaaggacaaatggatctatgtgtcacatctggc
agccaacaaggtctttgtaaggtgtttgaaatgatcattaatcctggagataatgtcctc
ctagatgaacctgcttattcaggaactcttcaaagtctgcacccactgggctgcaacatt
attaatgttgccagtgatgaaagtgggattgttccagattccctaagagacatactttcc
agatggaaaccagaagatgcaaagaatccccagaaaaacacccccaaatttctttatact
gttccaaatggcaacaaccctactggaaactcattaaccagtgaacgcaaaaaggaaatc
tatgagcttgcaagaaaatatgatttcctcataatagaagatgatccttactattttctc
cagtttaacaagttcagggtaccaacatttctttccatggatgttgatggacgtgtcatc
agagctgactctttttcaaaaatcatttcctctgggttgagaataggatttttaactggt
ccaaaacccttaatagagagagttattttacacatacaagtttcaacattgcaccccagc
acttttaaccagctcatgatatcacagcttctacacgaatggggagaagaaggtttcatg
gctcatgtagacagggttattgatttctatagtaaccagaaggatgcaatactggcagct
gcagacaagtggttaactggtttggcagaatggcatgttcctgctgctggaatgttttta
tggattaaagttaaaggcattaatgatgtaaaagaactgattgaagaaaaggccgttaag
atgggggtattaatgctccctggaaatgctttctacgtcgatagctcagctcctagccct
tacttgagagcatccttctcttcagcttctccagaacagatggatgtggccttccaggta
ttagcacaacttataaaagaatctttatga

DBGET integrated database retrieval system