KEGG   Homo sapiens (human): 51166Help
Entry
51166             CDS       T01001                                 

Gene name
AADAT, KAT2, KATII, KYAT2
Definition
(RefSeq) aminoadipate aminotransferase
  KO
K00825  
kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Tryptophan metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    51166 (AADAT)
  Amino acid metabolism
   00300 Lysine biosynthesis
    51166 (AADAT)
   00310 Lysine degradation
    51166 (AADAT)
   00380 Tryptophan metabolism
    51166 (AADAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     51166 (AADAT)
    2.6.1.39  2-aminoadipate transaminase
     51166 (AADAT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   51166 (AADAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8N5Z0(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
4q33
AA seq 425 aa AA seqDB search
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcacggttcatcacggcagcgagcgcagccagaaacccttctcccatccgg
accatgactgacatattgagcagaggaccaaaatcgatgatctccttggctggtggctta
ccaaatccaaacatgtttccttttaagactgccgtaatcactgtagaaaatggaaagacc
atccaatttggagaagagatgatgaagagagcacttcagtattctccgagtgctggaatt
ccagagcttttgtcctggctaaaacagttacaaataaaattgcataatcctcctaccatc
cattacccacccagtcaaggacaaatggatctatgtgtcacatctggcagccaacaaggt
ctttgtaaggtgtttgaaatgatcattaatcctggagataatgtcctcctagatgaacct
gcttattcaggaactcttcaaagtctgcacccactgggctgcaacattattaatgttgcc
agtgatgaaagtgggattgttccagattccctaagagacatactttccagatggaaacca
gaagatgcaaagaatccccagaaaaacacccccaaatttctttatactgttccaaatggc
aacaaccctactggaaactcattaaccagtgaacgcaaaaaggaaatctatgagcttgca
agaaaatatgatttcctcataatagaagatgatccttactattttctccagtttaacaag
ttcagggtaccaacatttctttccatggatgttgatggacgtgtcatcagagctgactct
ttttcaaaaatcatttcctctgggttgagaataggatttttaactggtccaaaaccctta
atagagagagttattttacacatacaagtttcaacattgcaccccagcacttttaaccag
ctcatgatatcacagcttctacacgaatggggagaagaaggtttcatggctcatgtagac
agggttattgatttctatagtaaccagaaggatgcaatactggcagctgcagacaagtgg
ttaactggtttggcagaatggcatgttcctgctgctggaatgtttttatggattaaagtt
aaaggcattaatgatgtaaaagaactgattgaagaaaaggccgttaagatgggggtatta
atgctccctggaaatgctttctacgtcgatagctcagctcctagcccttacttgagagca
tccttctcttcagcttctccagaacagatggatgtggccttccaggtattagcacaactt
ataaaagaatctttatga

DBGET integrated database retrieval system