KEGG   Homo sapiens (human): 51166Help
Entry
51166             CDS       T01001                                 

Gene name
AADAT, KAT2, KATII, KYAT2
Definition
(RefSeq) aminoadipate aminotransferase (EC:2.6.1.7 2.6.1.39)
  KO
K00825  
kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine biosynthesis
Lysine degradation
Tryptophan metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    51166 (AADAT)
   01230 Biosynthesis of amino acids
    51166 (AADAT)
  Amino acid metabolism
   00300 Lysine biosynthesis
    51166 (AADAT)
   00310 Lysine degradation
    51166 (AADAT)
   00380 Tryptophan metabolism
    51166 (AADAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     51166 (AADAT)
    2.6.1.39  2-aminoadipate transaminase
     51166 (AADAT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   51166 (AADAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q33
AA seq 425 aa AA seqDB search
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcacggttcatcacggcagcgagcgcagccagaaacccttctcccatccgg
accatgactgacatattgagcagaggaccaaaatcgatgatctccttggctggtggctta
ccaaatccaaacatgtttccttttaagactgccgtaatcactgtagaaaatggaaagacc
atccaatttggagaagagatgatgaagagagcacttcagtattctccgagtgctggaatt
ccagagcttttgtcctggctaaaacagttacaaataaaattgcataatcctcctaccatc
cattacccacccagtcaaggacaaatggatctatgtgtcacatctggcagccaacaaggt
ctttgtaaggtgtttgaaatgatcattaatcctggagataatgtcctcctagatgaacct
gcttattcaggaactcttcaaagtctgcacccactgggctgcaacattattaatgttgcc
agtgatgaaagtgggattgttccagattccctaagagacatactttccagatggaaacca
gaagatgcaaagaatccccagaaaaacacccccaaatttctttatactgttccaaatggc
aacaaccctactggaaactcattaaccagtgaacgcaaaaaggaaatctatgagcttgca
agaaaatatgatttcctcataatagaagatgatccttactattttctccagtttaacaag
ttcagggtaccaacatttctttccatggatgttgatggacgtgtcatcagagctgactct
ttttcaaaaatcatttcctctgggttgagaataggatttttaactggtccaaaaccctta
atagagagagttattttacacatacaagtttcaacattgcaccccagcacttttaaccag
ctcatgatatcacagcttctacacgaatggggagaagaaggtttcatggctcatgtagac
agggttattgatttctatagtaaccagaaggatgcaatactggcagctgcagacaagtgg
ttaactggtttggcagaatggcatgttcctgctgctggaatgtttttatggattaaagtt
aaaggcattaatgatgtaaaagaactgattgaagaaaaggccgttaagatgggggtatta
atgctccctggaaatgctttctacgtcgatagctcagctcctagcccttacttgagagca
tccttctcttcagcttctccagaacagatggatgtggccttccaggtattagcacaactt
ataaaagaatctttatga

DBGET integrated database retrieval system