KEGG   Homo sapiens (human): 51196Help
Entry
51196             CDS       T01001                                 

Gene name
PLCE1, NPHS3, PLCE, PPLC
Definition
phospholipase C, epsilon 1 (EC:3.1.4.11)
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H00626  
Nephrotic syndrome and focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51196 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    51196 (PLCE1)
   04015 Rap1 signaling pathway
    51196 (PLCE1)
   04020 Calcium signaling pathway
    51196 (PLCE1)
   04070 Phosphatidylinositol signaling system
    51196 (PLCE1)
   04024 cAMP signaling pathway
    51196 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    51196 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    51196 (PLCE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     51196 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23
AA seq 1994 aa AA seqDB search
MVSEGSAAGRDFAGMEEVRQLHVRFCKGIKIWHQAWFLCSLLGREPQEREAGCQLWLCTL
SAVLKVGWLFPLSEVPNFTLLKDGCGCWRLKEDQIYNAVRREETENTVGSLLHFLTKLPA
SETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSGLLSTFG
GSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQTIYR
RVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWV
TWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDI
ETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCP
RYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDS
PSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPW
YVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPASSKAKL
GVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSMFLS
ETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYV
SLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKK
KILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANPPNPLPSRR
AHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKGFQSFMV
SDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIDENTSDLQ
PDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQ
LNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFASKNDESQ
ENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMP
IIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEK
LVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLASMQVQAYN
GGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEIPKRIK
KADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGS
SRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPTTSLSAI
IRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHG
IQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDP
AVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHV
HFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRM
EENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTN
EQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGYMGRIV
LKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQT
LCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGA
GKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKP
VGGLSSSDTMDYRQ
NT seq 5985 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagaaggaagtgcagcaggaagagactttgcaggaatggaagaggtgaggcag
ctccacgtgagattctgcaaagggattaagatttggcaccaggcttggtttctgtgcagc
ctcttaggcagagagccccaggagagggaagcaggctgtcagctgtggctttgcacgctc
tcagctgtcttgaaggttggttggctcttcccgctctctgaggtacccaattttaccttg
ttaaaggatggatgtggatgctggaggcttaaagaagaccagatctacaatgcagtgaga
agagaagaaacagaaaatacagttggatctctactccatttcctcaccaagctcccagcc
tccgagacagcccatggaaggataagcgttggtccatgcttaaagcaatgtgtccgagac
actgtatgtgagtatcgcgccaccctccaaaggacttcaatatcgcagtacatcaccggt
tctctcctagaagcaaccacgtctttgggagcaagaagtggccttctcagtacttttgga
ggatccactggacgaatgatgctgaaagaacgccagccaggcccctctgtggccaattcc
aatgccctcccttcaagttcagctgggatcagcaaggagctgatcgatctgcagcctctc
atccagttcccagaggaagtcgccagcatcctgatggagcaagagcagactatttaccgc
agggtcttgccagtcgactacctttgcttcttaacacgggacttgggcactcctgaatgc
cagagctccttgccctgcctcaaagcatccatctcagcgtcgattcttaccactcagaat
ggagagcacaatgcccttgaagatctggtgatgaggtttaatgaggtgagctcctgggtg
acatggctgatcctcacggcaggctccatggaggagaagcgagaagtcttttcatatttg
gtgcatgtggccaaatgctgctggaacatgggcaactacaacgctgtcatggagttcttg
gctggcctcaggtcaagaaaagttttaaaaatgtggcagttcatggaccagtctgatatt
gagaccatgaggagcctgaaggatgctatggcccagcatgagtcctcttgtgagtacaga
aaggtggtgacacgtgccctgcacatccctggctgtaaggtggttccattctgtggggtg
tttctgaaggagctctgtgaagtgcttgacggcgcctccggtctcatgaagctttgcccg
cggtacaattcccaagaagaaactttagagtttgtagcagattacagtggacaagataat
ttcttacaacgagtgggacaaaatggcttaaagaattcggagaaggagtccactgtcaac
agcatctttcaggtcatccggagctgcaatcgaagtctggagacagacgaggaggacagc
cccagtgaaggaaacagctccaggaaaagctccttgaaggataaaagccgatggcagttt
ataattggagatttgttggattcagacaatgacatctttgagcaatccaaagaatacgac
tctcatggttcagaggactcacagaaggccttcgaccatgggacggagctcatcccttgg
tacgtgctgtccatccaagccgatgtgcaccagttcctgctgcagggggccacggtcatc
cactacgaccaggacacacacctctctgcccgctgcttcctccagcttcagcccgacaat
agcaccttgacctgggtaaagcccacaactgcctccccagccagcagtaaagcaaaactt
ggtgtacttaataacacagctgagcctggaaaattcccactactgggtaatgctggatta
agtagcctgacggaaggggtcttggatctttttgcagtgaaggctgtatacatgggccac
cctggcattgatatacacactgtgtgtgttcagaacaaactgggtagcatgttcctgtca
gagactggtgtgacattgctctatgggcttcagaccacagacaacagattattgcacttc
gtggcaccaaagcacacagctaaaatgctcttcagcggattattggaactcactagagct
gtgagaaagatgaggaaattccctgaccaaagacagcagtggctgcggaaacagtacgtc
agcctttatcaggaggatggacggtatgaaggcccaactttggctcacgctgtggagttg
tttggtggcagacggtggagtgctcgaaaccccagccccggaacatcagcaaagaatgct
gagaagcccaatatgcagagaaacaataccctgggcataagcactaccaagaaaaagaag
aaaatcctcatgaggggtgagagtggagaggtaactgacgatgagatggcaacccgaaag
gccaagatgcacaaagagtgtcgaagccggagtggttctgatcctcaagacattaatgaa
caagaagaatcagaggtgaatgccatcgctaaccctccaaaccccctcccttccagaaga
gcccactctttgaccacagctgggtcccccaacttggctgccgggacgtcatctcccatc
aggccagtgtcctcccctgtgctgtcttcttcaaacaagagcccatccagtgcttggagc
agtagtagctggcacgggcggatcaaaggcggcatgaagggatttcagagcttcatggtt
tcagatagcaacatgagttttgttgaatttgttgagctgttcaaatcattcagtgtcagg
agccgcaaggacctgaaggatctgtttgatgtctatgcagtgccctgcaaccgatctggc
tccgagtcagccccactctacaccaacctgacaattgatgaaaacaccagcgatcttcag
cctgacctagatctgttgaccagaaatgtctcggatttggggttgttcattaagagtaaa
cagcagctatcggacaaccagaggcagatatctgatgccattgctgctgcaagcattgtg
acaaatggcactgggattgagagcacatctctgggcatttttggggtgggcatacttcag
ctcaacgatttcctcgtgaattgccaaggagaacactgcacttatgatgaaatcctcagc
atcatccagaagttcgagcctagcatcagtatgtgtcatcagggactaatgtcatttgaa
gggtttgccaggtttctgatggataaagaaaattttgcctcaaaaaatgatgagtcacag
gagaacattaaagaactgcagctacccctctcatactattacatcgaatcttcgcacaat
acctacctcacgggccatcagctcaaaggagaatcctcggtagaactctacagccaggtc
cttttgcaaggctgtcgaagtgtagaattggactgctgggacggagacgatgggatgccc
atcatttatcatggacatacgctgacaaccaagatccccttcaaggaagtggttgaagcc
attgatcgcagtgccttcatcaactctgacctgccaatcatcatatcgattgagaaccac
tgttcattgcctcagcaacgaaaaatggcagaaattttcaagactgtgtttggagaaaag
ctggtgactaaattcttatttgagactgatttctcagatgatccaatgcttccttcacct
gaccaactcagaaagaaagttcttcttaaaaacaagaagctaaaagcccatcagacgcca
gtggatatcttaaagcaaaaggctcatcagttagcatctatgcaagtgcaggcttataat
ggtgggaatgccaacccccgacctgccaataatgaggaagaggaagatgaggaggacgaa
tatgattatgactatgaatccctttctgatgacaacattctggaagacagacctgaaaat
aaatcatgtaatgacaagcttcagtttgaatataatgaagaaatcccaaagaggataaag
aaagcagataactctgcttgcaacaaaggaaaggtttatgatatggaactgggagaagaa
ttttatcttgatcagaataaaaaggaaagcagacagattgcaccagagctttctgacctt
gtaatctattgtcaagcagtaaaatttccaggactgtcaactctaaatgcatctggctct
agcagaggaaaagaaaggaaaagcaggaagtccatttttggcaacaatccgggcagaatg
agcccaggggagacagcatcatttaacaaaacatctggaaaaagttcctgtgaaggcatt
cgacagacctgggaggaatcttcttcccctctcaacccaaccacgtccctcagtgctatc
attagaactcccaaatgttatcatatctcgtcgctgaatgaaaatgccgccaaacgtctg
tgtcgcaggtattctcagaaactgacccagcacaccgcctgtcagctgctgagaacttac
cctgctgccacccgcatcgactcttccaacccgaaccccctcatgttctggctccatggg
atacagcttgtggcactcaactaccagactgatgatctccctttacatttaaatgctgca
atgtttgaggcaaatggtggttgtggttatgtattgaaacctccagttctgtgggacaag
aactgccccatgtatcagaagttttctccactagaaagagatctggacagcatggatcct
gcagtctattctttaactattgtctctggtcagaatgtgtgccccagtaatagcatggga
agcccgtgcattgaagtcgacgtcctgggcatgcctctggacagctgccatttccgcaca
aagcccatccatcgaaacaccctgaaccccatgtggaacgagcagtttctgttccacgtt
cacttcgaagatcttgtatttcttcgttttgcagttgtggaaaacaatagttcagcggta
actgctcagagaatcattccactgaaagctttaaaacgaggatatcgacatcttcagctg
cgaaaccttcacaatgaagtcttggagatttctagtttattcattaacagcagaaggatg
gaagaaaattcctctggcaataccatgtcagcctcttcgatgtttaatacagaagaaaga
aaatgtttgcagactcacagagtcacggtgcatggggtcccagggccagagccctttacc
gttttcactattaatggaggcaccaaggcaaagcagcttctgcagcaaattctgacaaat
gaacaagacatcaaacctgttaccacagactattttttgatggaagaaaaatattttata
tctaaagaaaagaatgaatgtaggaaacaaccattccagagagccattggtccagaagag
gagatcatgcaaattttaagcagctggtttccagaagagggatacatgggcaggattgtc
ttaaaaacccagcaggaaaacctagaagagaaaaacattgttcaagatgacaaagaggtg
atcttgagctcagaggaggagagtttctttgtccaagtgcatgatgtttctccagagcaa
cctcgaacagtcatcaaagcaccccgcgtcagcactgcacaggatgtcattcagcagacc
ttatgcaaagccaaatattcctacagcatcctgagcaaccccaatccaagcgactatgtg
cttttggaagaggtggtgaaagacactaccaacaagaagactaccacaccaaagtcctct
cagcgggtccttctggatcaggagtgtgtgtttcaagcccaaagcaagtggaaaggtgca
ggaaaattcatccttaagctaaaggagcaggtgcaggcatctcgagaagataaaaagaaa
ggcatttctttcgcaagtgaactcaagaagctcaccaagtcaactaaacagccccgagga
cttacatcaccttctcagctcttgacctcagaaagtatccaaaccaaggaggagaaacct
gtgggtggcttgtcctccagtgacacaatggattaccgacagtga

DBGET integrated database retrieval system