KEGG   Homo sapiens (human): 51259Help
Entry
51259             CDS       T01001                                 

Gene name
TMEM216, CORS2, MKS2
Definition
transmembrane protein 216
Organism
hsa  Homo sapiens (human)
Disease
H00530  
Joubert syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q13.1
AA seq 145 aa AA seqDB search
MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDV
VMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIM
NGILLFFCGSELLLEVLTLAAFSRI
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgctgccacggggactgaagatggcgccgcgaggtaaacggttgtcctccaccccgctg
gaaatcctgttctttctgaacgggtggtataatgctacctatttcctgctggaacttttc
atatttctgtataaaggtgtcctgctaccatatccaacagctaacctagtactggatgtg
gtgatgctcctcctttatcttggaattgaagtaattcgcctgttttttggtacaaaggga
aacctctgccagcgaaagatgccgctcagtattagcgtggccttgaccttcccatctgcc
atgatggcctcctattacctgctgctgcagacctacgtactccgcctggaagccatcatg
aatggcatcttgctcttcttctgtggctcagagcttttacttgaggtgctcaccttggct
gctttctccaggatttga

DBGET integrated database retrieval system