KEGG   Homo sapiens (human): 51259Help
Entry
51259             CDS       T01001                                 

Gene name
TMEM216, CORS2, MKS2
Definition
transmembrane protein 216
Organism
hsa  Homo sapiens (human)
Disease
H00530  
Joubert syndrome
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q13.1
AA seq 145 aa AA seqDB search
MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDV
VMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIM
NGILLFFCGSELLLEVLTLAAFSRI
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgctgccacggggactgaagatggcgccgcgaggtaaacggttgtcctccaccccgctg
gaaatcctgttctttctgaacgggtggtataatgctacctatttcctgctggaacttttc
atatttctgtataaaggtgtcctgctaccatatccaacagctaacctagtactggatgtg
gtgatgctcctcctttatcttggaattgaagtaattcgcctgttttttggtacaaaggga
aacctctgccagcgaaagatgccgctcagtattagcgtggccttgaccttcccatctgcc
atgatggcctcctattacctgctgctgcagacctacgtactccgcctggaagccatcatg
aatggcatcttgctcttcttctgtggctcagagcttttacttgaggtgctcaccttggct
gctttctccaggatttga

DBGET integrated database retrieval system