KEGG   Homo sapiens (human): 5126Help
Entry
5126              CDS       T01001                                 

Gene name
PCSK2, NEC_2, NEC-2, NEC2, PC2, SPC2
Definition
proprotein convertase subtilisin/kexin type 2 (EC:3.4.21.94)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     5126 (PCSK2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S8: subtilisin family
   5126 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.2
AA seq 619 aa AA seqDB search
MVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKR
RRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQAD
GTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPR
YTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMP
QLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC
DGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLR
HSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFN
HLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKEN
FVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHT
WGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEEL
EEELDEAVERSLKSILNKN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggtttttgcatctgctgagcgaccggtcttcacgaatcattttcttgtggagttgcat
aaagggggagaggacaaagctcgccaagttgcagcagaacacggctttggagtccgaaag
cttccctttgctgaaggtctgtaccacttttatcacaatggccttgcaaaggccaagaga
agacgcagcctacaccacaagcagcagctggagagagaccccagggtaaagatggctttg
cagcaggaaggatttgaccgaaaaaagcgaggttacagagacatcaatgagatcgacatc
aacatgaacgatcctctttttacaaagcagtggtatctgatcaatactgggcaagctgat
ggcactcctggccttgatttgaatgtggctgaagcctgggagctgggatacacagggaaa
ggtgttaccattggaattatggatgatgggattgactatctccacccggacctggcctcc
aactataatgccgaagcaagttacgacttcagcagcaacgacccctatccttaccctcgg
tacacagatgactggtttaacagccacgggacccgatgtgcaggagaagtttctgctgcc
gccaacaacaatatctgtggagttggagtagcatacaactccaaggttgcaggcatccgg
atgctggaccagccattcatgacagacatcatcgaggcctcctccatcagtcatatgcca
cagctgattgacatctacagcgccagctggggccccacagacaacggcaagacagtggat
gggccccgggagctcacgctgcaggccatggccgatggcgtgaacaagggccgcggcggc
aaaggcagcatctacgtgtgggcctccggggacggcggcagctatgacgactgcaactgc
gacggctacgcctccagcatgtggaccatctccatcaactcagccatcaacgacggcagg
actgccctgtacgacgagagctgctcttccaccttggcttccaccttcagcaacgggagg
aaaaggaaccccgaggccggtgtggcaaccacagatttgtacggcaactgcactctgagg
cattctgggacatctgcagctgcccccgaggcagctggtgtgtttgcactggctctggag
gctaacctgggtctgacctggcgggacatgcagcatctgactgtgctcacctccaaacgg
aaccagcttcacgacgaggtccatcagtggcggcgcaatggggtcggcctggaatttaat
cacctctttggctacggggtccttgatgcaggtgccatggtgaaaatggctaaagactgg
aaaaccgtgcctgagagattccactgtgtgggaggctccgtgcaggaccctgagaaaata
ccatccactggcaagttggtgctgacactcacaaccgacgcctgtgaggggaaggaaaat
tttgtccgctacctggagcatgtccaggctgtcatcacggtcaacgcaaccagaagagga
gacctgaacatcaacatgacttcccctatgggcaccaagtccattttgctgagccggcgt
ccaagggatgacgactccaaggtgggctttgacaagtggcctttcatgaccactcacacg
tggggggaagacgcccgaggcacctggaccctggagctgggatttgtcggcagcgccccg
cagaagggggtgctgaaggagtggaccctgatgctgcatggcactcagagtgccccgtac
atcgaccaggtggtgcgggattaccagtccaagttggccatgtccaagaaagaggagctg
gaggaagagctggacgaagccgtggagagaagcctgaaaagcatccttaacaagaactag

DBGET integrated database retrieval system