KEGG   Homo sapiens (human): 51317Help
Entry
51317             CDS       T01001                                 

Gene name
PHF21A, BHC80
Definition
PHD finger protein 21A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 680 aa AA seqDB search
MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEKQKRVVEQLRK
NLIVKQEQPDKFQIQPLPQSENKLQTAQQQPLQQLQQQQQYHHHHAQQSAAASPNLTASQ
KTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNL
QTSSKVTGPGAEAVQIVAKNTVTLVQATPPQPIKVPQFIPPPRLTPRPNFLPQVRPKPVA
QNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPM
AQLTSIVIATPGTRLAGPQTVQLSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKRE
ENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNST
MHPGTRKRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPT
STDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKE
EAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEM
KNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTP
APSPSSQSCTANCNQGEETK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggagttgcagactctacaggaggctcttaaagtggaaattcaggttcaccagaaactg
gttgctcaaatgaagcaggatccacagaatgctgacttaaagaaacagcttcatgaactc
caagccaaaatcacagctttgagtgagaaacagaaaagagtagttgaacagctacggaag
aacctgatagtaaagcaagaacaaccggacaagttccaaatacagccattgccacaatct
gaaaacaaactacaaacagcacagcagcaaccactacagcaactacaacaacagcagcag
taccaccaccaccacgcccagcagtcagctgcagcctctcccaacctgactgcttcacag
aagactgtaactacagcttctatgattaccacaaagacactacctctcgtcttgaaagca
gcaactgcgaccatgcctgcctctgtggtgggccagagacctaccattgctatggtgacc
gccatcaacagtcagaaggctgtgctcagcactgatgtgcagaacacaccagtcaacctc
cagacgtctagtaaggtcactgggcctggggcagaggctgtccaaattgtggcaaaaaac
acagtcactctggttcaggcaacacctcctcagcccatcaaagtaccacagtttatcccc
cctcctagactcactccacgtccaaactttcttccacaggttcgacccaagcctgtggcc
cagaataacattcctattgccccagcaccacctcccatgctcgcagctcctcagcttatc
cagaggcccgtcatgctgaccaagttcacccccacaacccttcccacatcccagaattcc
atccaccccgtccgtgtcgtcaatgggcagactgcaaccatagccaaaacgttccccatg
gcccagctcaccagcattgtgatagctactccagggaccagactcgctggacctcaaact
gtacagcttagcaagccaagtcttgaaaaacagacagttaaatctcacacagaaacagat
gagaaacaaacagagagccgcaccatcaccccacctgctgcacccaaaccaaaacgggag
gagaaccctcagaaacttgccttcatggtgtctctagggttggtaacacatgaccatcta
gaagaaatccaaagcaagaggcaagagcgaaaaagaagaacaacagcaaatccggtctac
agtggagcagtctttgagccagagcgtaagaagagtgcagtgacatacctaaacagcaca
atgcaccctgggacccggaagagaggtcgtcctccaaaatacaatgcagtgctggggttt
ggagcccttaccccaacatccccccaatccagtcatcctgactcccctgaaaatgaaaag
acagagaccacattcactttccctgcacctgttcagcctgtgtccctgcccagccccacc
tccacagacggtgatattcatgaggatttttgcagcgtttgcagaaaaagtggccagtta
ctgatgtgcgacacatgttcccgtgtatatcatttggactgcttagacccccctctgaaa
acaattcccaagggcatgtggatctgtcccagatgtcaggaccagatgctgaagaaggaa
gaagcaattccatggcctggaactttagcaattgttcattcctatattgcctacaaagca
gcaaaagaagaagagaaacagaagttacttaaatggagttcagatttaaaacaagaacga
gaacaactagagcaaaaggtgaaacagctcagcaattccataagtaaatgcatggaaatg
aagaacaccatcctggcccggcagaaggagatgcacagctccctggagaaggtaaaacag
ctgattcgcctcatccacggcatcgacctctccaaacctgtagactctgaggccactgtg
ggggccatctccaatggcccggactgcaccccccctgccaatgccgccacctccacgccg
gccccttccccctcctcccagagctgcacagcgaactgtaaccagggggaagagactaaa
taa

DBGET integrated database retrieval system