KEGG   Homo sapiens (human): 5136Help
Entry
5136              CDS       T01001                                 

Gene name
PDE1A, CAM-PDE-1A, HCAM-1, HCAM1, HSPDE1A
Definition
phosphodiesterase 1A, calmodulin-dependent (EC:3.1.4.17)
Orthology
K13755  
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Calcium signaling pathway
Taste transduction
Morphine addiction
Drug target
Papaverine: 
Moxaverine: 
Trapidil: 
Flavoxate: 
Caffeine: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Other: 
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.1
AA seq 535 aa AA seqDB search
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggggtctagtgccacagagattgaagaattggaaaacaccacttttaagtatcttaca
ggagaacagactgaaaaaatgtggcagcgcctgaaaggaatactaagatgcttggtgaag
cagctggaaagaggtgatgttaacgtcgtcgacttaaagaagaatattgaatatgcggca
tctgtgctggaagcagtttatatcgatgaaacaagaagacttctggatactgaagatgag
ctcagtgacattcagactgactcagtcccatctgaagtccgggactggttggcttctacc
tttacacggaaaatggggatgacaaaaaagaaacctgaggaaaaaccaaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaagaatgtaccgaaaaacatatcat
atggttggtttggcatatccagcagctgtcatcgtaacattaaaggatgttgataaatgg
tctttcgatgtatttgccctaaatgaagcaagtggagagcatagtctgaagtttatgatt
tatgaactgtttaccagatatgatcttatcaaccgtttcaagattcctgtttcttgccta
atcacctttgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttgattcatgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagcaatggtctttgctgctgccattcatgat
tatgagcatacagggacaacaaacaactttcacattcagacaaggtcagatgttgccatt
ttgtataatgatcgctctgtccttgagaatcaccacgtgagtgcagcttatcgacttatg
caagaagaagaaatgaatatcttgataaatttatccaaagatgactggagggatcttcgg
aacctagtgattgaaatggttttatctacagacatgtcaggtcacttccagcaaattaaa
aatataagaaacagtttgcagcagcctgaagggattgacagagccaaaaccatgtccctg
attctccacgcagcagacatcagccacccagccaaatcctggaagctgcattatcggtgg
accatggccctaatggaggagtttttcctgcagggagataaagaagctgaattagggctt
ccattttccccactttgtgatcggaagtcaaccatggtggcccagtcacaaataggtttc
atcgatttcatagtagagccaacattttctcttctgacagactcaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccgaaacttcttcctatgtggcaagcagctca
accaccattgtggggttacacattgctgatgcactaagacgatcaaatacaaaaggctcc
atgagtgatgggtcctattccccagactactcccttgcagcagtggacctgaagagtttc
aagaacaacctggtggacatcattcagcagaacaaagagaggtggaaagagttagctgca
caagaagcaagaaccagttcacagaagtgtgagtttattcatcagtaa

DBGET integrated database retrieval system