KEGG   Homo sapiens (human): 5136Help
Entry
5136              CDS       T01001                                 

Gene name
PDE1A, CAM-PDE-1A, HCAM-1, HCAM1, HSPDE1A
Definition
phosphodiesterase 1A, calmodulin-dependent (EC:3.1.4.17)
Orthology
K13755  
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Calcium signaling pathway
Taste transduction
Morphine addiction
Drug target
Papaverine: 
Moxaverine: 
Trapidil: 
Flavoxate: 
Caffeine: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5136 (PDE1A)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5136 (PDE1A)
 Organismal Systems
  Sensory system
   04742 Taste transduction
    5136 (PDE1A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5136 (PDE1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5136 (PDE1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.1
AA seq 535 aa AA seqDB search
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggggtctagtgccacagagattgaagaattggaaaacaccacttttaagtatcttaca
ggagaacagactgaaaaaatgtggcagcgcctgaaaggaatactaagatgcttggtgaag
cagctggaaagaggtgatgttaacgtcgtcgacttaaagaagaatattgaatatgcggca
tctgtgctggaagcagtttatatcgatgaaacaagaagacttctggatactgaagatgag
ctcagtgacattcagactgactcagtcccatctgaagtccgggactggttggcttctacc
tttacacggaaaatggggatgacaaaaaagaaacctgaggaaaaaccaaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaagaatgtaccgaaaaacatatcat
atggttggtttggcatatccagcagctgtcatcgtaacattaaaggatgttgataaatgg
tctttcgatgtatttgccctaaatgaagcaagtggagagcatagtctgaagtttatgatt
tatgaactgtttaccagatatgatcttatcaaccgtttcaagattcctgtttcttgccta
atcacctttgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttgattcatgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagcaatggtctttgctgctgccattcatgat
tatgagcatacagggacaacaaacaactttcacattcagacaaggtcagatgttgccatt
ttgtataatgatcgctctgtccttgagaatcaccacgtgagtgcagcttatcgacttatg
caagaagaagaaatgaatatcttgataaatttatccaaagatgactggagggatcttcgg
aacctagtgattgaaatggttttatctacagacatgtcaggtcacttccagcaaattaaa
aatataagaaacagtttgcagcagcctgaagggattgacagagccaaaaccatgtccctg
attctccacgcagcagacatcagccacccagccaaatcctggaagctgcattatcggtgg
accatggccctaatggaggagtttttcctgcagggagataaagaagctgaattagggctt
ccattttccccactttgtgatcggaagtcaaccatggtggcccagtcacaaataggtttc
atcgatttcatagtagagccaacattttctcttctgacagactcaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccgaaacttcttcctatgtggcaagcagctca
accaccattgtggggttacacattgctgatgcactaagacgatcaaatacaaaaggctcc
atgagtgatgggtcctattccccagactactcccttgcagcagtggacctgaagagtttc
aagaacaacctggtggacatcattcagcagaacaaagagaggtggaaagagttagctgca
caagaagcaagaaccagttcacagaagtgtgagtttattcatcagtaa

DBGET integrated database retrieval system