KEGG   Homo sapiens (human): 5137Help
Entry
5137              CDS       T01001                                 

Gene name
PDE1C, Hcam3, cam-PDE_1C, hCam-3
Definition
phosphodiesterase 1C, calmodulin-dependent 70kDa (EC:3.1.4.17)
Orthology
K13755  
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Calcium signaling pathway
Olfactory transduction
Morphine addiction
Drug target
Papaverine: 
Moxaverine: 
Trapidil: 
Flavoxate: 
Caffeine: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5137 (PDE1C)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5137 (PDE1C)
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    5137 (PDE1C)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5137 (PDE1C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5137 (PDE1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p14.3
AA seq 634 aa AA seqDB search
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgccaaccaaggagattgaagaatttgagagcaactctctgaaatacctgcaa
ccggaacagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagagattacggtctttggtcaaacaattagagagaggggaagcttcagtggtagat
cttaagaagaatttggaatatgcagccacagtgcttgaatctgtgtatattgatgaaaca
aggagactcctggatacagaggatgagctcagtgacattcagtcagatgctgtgccttct
gaggtccgagactggctggcctccaccttcacgcggcagatggggatgatgctcaggagg
agcgacgagaagccccggttcaagagcatcgttcacgcagtgcaggctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttggactgagctatccaccagctgttatt
gaggcattaaaggatgtggacaagtggtcctttgacgtcttttccctcaatgaggccagt
ggggatcatgcactgaaatttattttctatgaactactcacacgttatgatctgatcagc
cgtttcaagatccccatttctgcacttgtctcatttgtggaggccctggaagtgggatac
agcaagcacaaaaatccttaccataacttaatgcacgctgccgatgttacacagacagtg
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatctttgct
ataatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcagactcggtctgatccagctattctgtataatgacagatctgtactggagaatcac
catttaagtgcagcttatcgccttctgcaagatgacgaggaaatgaatattttgattaac
ctctcaaaggatgactggagggagtttcgaaccttggtaattgaaatggtgatggccaca
gatatgtcttgtcacttccaacaaatcaaagcaatgaagactgctctgcagcagccagaa
gccattgaaaagccaaaagccttatcccttatgctgcatacagcagatattagccatcca
gcaaaagcatgggacctccatcatcgctggacaatgtcactcctggaggagttcttcaga
cagggtgacagagaagcagagctggggctgcctttttctcctctgtgtgaccgaaagtcc
actatggttgctcagtcacaagtaggtttcattgatttcatcgtggaacccaccttcact
gtgcttacggacatgaccgagaagattgtgagtccattaatcgatgaaacctctcaaact
ggtgggacaggacagaggcgttcgagtttgaatagcatcagctcgtcagatgccaagcga
tcaggtgtcaagacctctggttcagagggaagtgccccgatcaacaattctgtcatctcc
gttgactataagagctttaaagctacttggacggaagtggtgcacatcaatcgggagaga
tggagggccaaggtacccaaagaggagaaggccaagaaggaagcagaggaaaaggctcgc
ctggccgcagaggagcagcaaaaggaaatggaagccaaaagccaggctgaagaaggcgca
tctggcaaagctgagaaaaagacgtctggagaaactaagaatcaagtcaatggaacacgg
gcaaacaaaagtgacaaccctcgtgggaaaaactccaaagccgagaagtcatcaggagaa
cagcaacagaatggtgacttcaaagatggtaaaaataagacagacaagaaggatcactct
aacatcggaaatgattcaaagaaaacagatgattcacaagagtaa

DBGET integrated database retrieval system