KEGG   Homo sapiens (human): 5138Help
Entry
5138              CDS       T01001                                 

Gene name
PDE2A, CGS-PDE, PDE2A1, PED2A4, cGSPDE
Definition
(RefSeq) phosphodiesterase 2A
  KO
K18283  
cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Olfactory transduction
Aldosterone synthesis and secretion
Morphine addiction
Module
cGMP signaling
Drug target
Aminophylline (DG01062): 
Bucladesine (DG00230): 
Caffeine (DG00974): 
Choline theophyllinate: 
Diprophylline: 
Flavoxate (DG00477): 
Moxaverine (DG00045): 
Papaverine (DG00043): 
Propentofylline: 
Proxyphylline: 
Theophylline (DG01061): 
Tibenelast sodium: 
Trapidil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5138 (PDE2A)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    5138 (PDE2A)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    5138 (PDE2A)
  Sensory system
   04740 Olfactory transduction
    5138 (PDE2A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5138 (PDE2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5138 (PDE2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O00408(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.4
AA seq 941 aa AA seqDB search
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggcatgcggccactccatcctctgcaggagccagcagtacccggcagcgcga
ccggctgagccgcggggccagcaggtcttcctcaagccggacgagccgccgccgccgccg
cagccatgcgccgacagcctgcaggacgccttgctgagtctgggctctgtcatcgacatt
tcaggcctgcaacgtgctgtcaaggaggccctgtcagctgtgctcccccgagtggaaact
gtctacacctacctactggatggtgagtcccagctggtgtgtgaggaccccccacatgag
ctgccccaggaggggaaagtccgggaggctatcatctcccagaagcggctgggctgcaat
gggctgggcttctcagacctgccagggaagcccttggccaggctggtggctccactggct
cctgatacccaagtgctggtcatgccgctagcggacaaggaggctggggccgtggcagct
gtcatcttggtgcactgtggccagctgagtgataatgaggaatggagcctgcaggcggtg
gagaagcataccctggtcgccctgcggagggtgcaggtcctgcagcagcgcgggcccagg
gaggctccccgagccgtccagaaccccccggaggggacggcggaagaccagaagggcggg
gcggcgtacaccgaccgcgaccgcaagatcctccaactgtgcggggaactctacgacctg
gatgcctcttccctgcagctcaaagtgctccaatacctgcagcaggagacccgggcatcc
cgctgctgcctcctgctggtgtcggaggacaatctccagctttcttgcaaggtcatcgga
gacaaagtgctcggggaagaggtcagctttcccttgacaggatgcctgggccaggtggtg
gaagacaagaagtccatccagctgaaggacctcacctccgaggatgtacaacagctgcag
agcatgttgggctgtgagctgcaggccatgctctgtgtccctgtcatcagccgggccact
gaccaggtggtggccttggcctgcgccttcaacaagctagaaggagacttgttcaccgac
gaggacgagcatgtgatccagcactgcttccactacaccagcaccgtgctcaccagcacc
ctggccttccagaaggaacagaaactcaagtgtgagtgccaggctcttctccaagtggca
aagaacctcttcacccacctggatgacgtctctgtcctgctccaggagatcatcacggag
gccagaaacctcagcaacgcagagatctgctctgtgttcctgctggatcagaatgagctg
gtggccaaggtgttcgacgggggcgtggtggatgatgagagctatgagatccgcatcccg
gccgatcagggcatcgcgggacacgtggcgaccacgggccagatcctgaacatccctgac
gcatatgcccatccgcttttctaccgcggcgtggacgacagcaccggcttccgcacgcgc
aacatcctctgcttccccatcaagaacgagaaccaggaggtcatcggtgtggccgagctg
gtgaacaagatcaatgggccatggttcagcaagttcgacgaggacctggcgacggccttc
tccatctactgcggcatcagcatcgcccattctctcctatacaaaaaagtgaatgaggct
cagtatcgcagccacctggccaatgagatgatgatgtaccacatgaaggtctccgatgat
gagtataccaaacttctccatgatgggatccagcctgtggctgccattgactccaatttt
gcaagtttcacctatacccctcgttccctgcccgaggatgacacgtccatggccatcctg
agcatgctgcaggacatgaatttcatcaacaactacaaaattgactgcccgaccctggcc
cggttctgtttgatggtgaagaagggctaccgggatcccccctaccacaactggatgcac
gccttttctgtctcccacttctgctacctgctctacaagaacctggagctcaccaactac
ctcgaggacatcgagatctttgccttgtttatttcctgcatgtgtcatgacctggaccac
agaggcacaaacaactctttccaggtggcctcgaaatctgtgctggctgcgctctacagc
tctgagggctccgtcatggagaggcaccactttgctcaggccatcgccatcctcaacacc
cacggctgcaacatctttgatcatttctcccggaaggactatcagcgcatgctggatctg
atgcgggacatcatcttggccacagacctggcccaccatctccgcatcttcaaggacctc
cagaagatggctgaggtgggctacgaccgaaacaacaagcagcaccacagacttctcctc
tgcctcctcatgacctcctgtgacctctctgaccagaccaagggctggaagactacgaga
aagatcgcggagctgatctacaaagaattcttctcccagggagacctggagaaggccatg
ggcaacaggccgatggagatgatggaccgggagaaggcctatatccctgagctgcaaatc
agcttcatggagcacattgcaatgcccatctacaagctgttgcaggacctgttccccaaa
gcggcagagctgtacgagcgcgtggcctccaaccgtgagcactggaccaaggtgtcccac
aagttcaccatccgcggcctcccaagtaacaactcgctggacttcctggatgaggagtac
gaggtgcctgatctggatggcactagggcccccatcaatggctgctgcagccttgatgct
gagtga

DBGET integrated database retrieval system