KEGG   Homo sapiens (human): 5140Help
Entry
5140              CDS       T01001                                 

Gene name
PDE3B, HcGIP1, cGIPDE1
Definition
(RefSeq) phosphodiesterase 3B, cGMP-inhibited (EC:3.1.4.17)
  KO
K13296  
cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
cAMP signaling pathway
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Morphine addiction
Drug target
Papaverine: 
Moxaverine: 
Cilostazol: 
Amrinone: 
Milrinone: 
Enoximone: 
Bucladesine: 
Levosimendan: 
Trapidil: 
Flavoxate: 
Anagrelide: 
Caffeine: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Ibudilast: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5140 (PDE3B)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5140 (PDE3B)
   04022 cGMP - PKG signaling pathway
    5140 (PDE3B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5140 (PDE3B)
   04922 Glucagon signaling pathway
    5140 (PDE3B)
   04923 Regulation of lipolysis in adipocyte
    5140 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    5140 (PDE3B)
   04924 Renin secretion
    5140 (PDE3B)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5140 (PDE3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5140 (PDE3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.1
AA seq 1112 aa AA seqDB search
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccctgcagccgccggatggggcc
ggctcgccccccgagagtctgaggaacggctacgtgaagagctgcgtgagccccttgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgcgg
ccgccgccggcctctccccagcagccgcggcgctgctcccccttctgccgggcgcgcctc
tcgctgggcgccctggctgcctttgtcctcgccctgctgctgggcgcggaacccgagagc
tgggctgccggggccgcctggctgcggacgctgctgagcgtgtgttcgcacagcttgagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctcacccggaccaag
cggggacccggcccgggccggagctgcggctcctggtggctgctggcgctgcccgcctgc
tgttacctgggggacttcttggtgtggcagtggtggtcttggccttggggggatggcgac
gcagggtccgcggccccgcacacgcccccggaggcggcagcgggcaggttgctgctggtg
ctgagctgcgtagggctgctgctgacgctcgcgcacccgctgcggctccggcactgcgtt
ctggtgctgctcctggccagcttcgtctggtgggtctccttcaccagcctcgggtcgctg
ccctccgccctcaggccgctgctctccggcctggtggggggcgctggctgcctgctggcc
ctggggttggatcacttctttcaaatcagggaagcgcctcttcatcctcgactgtccagt
gccgccgaagaaaaagtgcctgtgatccgaccccggaggaggtccagctgcgtgtcgtta
ggagaaactgcagccagttactatggcagttgcaaaatattcaggagaccgtcgttgcct
tgtatttccagagaacagatgattctttgggattgggacttaaaacaatggtataagcct
cattatcaaaattctggaggtggaaatggagttgatctttcagtgctaaatgaggctcgc
aatatggtgtcagatcttctgactgatccaagccttccaccacaagtcatttcctctcta
cggagtattagtagcttaatgggtgctttctcaggttcctgtaggccaaagattaatcct
ctcacaccatttcctggattttacccctgttctgaaatagaggacccagctgagaaaggg
gatagaaaacttaacaagggactaaataggaatagtttgccaactccacagctgaggaga
agctcaggaacttcaggattgctacctgttgaacagtcttcaaggtgggatcgtaataat
ggcaaaagacctcaccaagaatttggcatttcaagtcaaggatgctatctaaatgggcct
tttaattcaaatctactgactatcccgaagcaaaggtcatcttctgtatcactgactcac
catgtaggtctcagaagagctggtgttttgtccagtctgagtcctgtgaattcttccaac
catggaccagtgtctactggctctctaactaatcgatcacccatagaatttcctgatact
gctgattttcttaataagccaagcgttatcttgcagagatctctgggcaatgcacctaat
actccagatttttatcagcaacttagaaattctgatagcaatctgtgtaacagctgtgga
catcaaatgctgaaatatgtttcaacatctgaatcagatggtacagattgctgcagtgga
aaatcaggtgaagaagaaaacattttctcgaaagaatcattcaaacttatggaaactcaa
caagaagaggaaacagagaagaaagacagcagaaaattatttcaggaaggtgataagtgg
ctaacagaagaggcacagagtgaacagcaaacaaatattgaacaggaagtatcactggac
ctgattttagtagaagagtatgactcattaatagaaaagatgagcaactggaattttcca
atttttgaacttgtagaaaagatgggagagaaatcaggaaggattctcagtcaggttatg
tataccttatttcaagacactggtttattggaaatatttaaaattcccactcaacaattt
atgaactattttcgtgcattagaaaatggctatcgagacattccttatcacaatcgtata
catgccacagatgtgctacatgcagtttggtatctgacaacacggccagttcctggctta
cagcagatccacaatggttgtggaacaggaaatgaaacagattctgatggtagaattaac
catgggcgaattgcttatatttcttcgaagagctgctctaatcctgatgagagttatggc
tgcctgtcttcaaacattcctgcattagaattgatggctctatacgtggcagctgccatg
catgattatgatcacccagggaggacaaatgcatttctagtggctacaaatgcccctcag
gcagttttatacaatgacagatctgttctggaaaatcatcatgctgcgtcagcttggaat
ctatatctttctcgcccagaatacaacttccttcttcatcttgatcatgtggaattcaag
cgctttcgttttttagtcattgaagcaatccttgctacggatcttaaaaagcattttgat
tttctcgcagaattcaatgccaaggcaaatgatgtaaatagtaatggcatagaatggagt
aatgaaaatgatcgcctcttggtatgccaggtgtgcatcaaactggcagatataaatggc
ccagcaaaagttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttat
gagcagggagatgaagaagcaaatcttggtctgcccatcagtccattcatggatcgttct
tctcctcaactagcaaaactccaagaatcttttatcacccacatagtgggtcccctgtgt
aactcctatgatgctgctggtttgctaccaggtcagtggttagaagcagaagaggataat
gatactgaaagtggtgatgatgaagacggtgaagaattagatacagaagatgaagaaatg
gaaaacaatctaaatccaaaaccaccaagaaggaaaagcagacggcgaatattttgtcag
ctaatgcaccacctcactgaaaaccacaagatatggaaggaaatcgtagaggaagaagaa
aaatgtaaagctgatgggaataaactgcaggtggagaattcctccttacctcaagcagat
gagattcaggtaattgaagaggcagatgaagaggaatag

DBGET integrated database retrieval system