KEGG   Homo sapiens (human): 5141Help
Entry
5141              CDS       T01001                                 

Gene name
PDE4A, DPDE2, PDE4, PDE46
Definition
phosphodiesterase 4A, cAMP-specific (EC:3.1.4.53)
Orthology
K13293  
cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cAMP signaling pathway
Morphine addiction
Drug target
Papaverine: 
Drotaverine: 
Moxaverine: 
Bucladesine: 
Trapidil: 
Flavoxate: 
Apremilast: 
Caffeine: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Doxofylline: 
Ibudilast: 
Roflumilast: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5141 (PDE4A)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5141 (PDE4A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5141 (PDE4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5141 (PDE4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 886 aa AA seqDB search
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggaacccccgaccgtcccctcggaaaggagcctgtctctgtcactgcccgggccccgg
gagggccaggccaccctgaagcctcccccgcagcacctgtggcggcagcctcggaccccc
atccgtatccagcagcgcggctactccgacagcgcggagcgcgccgagcgggagcggcag
ccgcaccggcccatagagcgcgccgatgccatggacaccagcgaccggcccggcctgcgc
acgacccgcatgtcctggccctcgtccttccatggcactggcaccggcagcggcggcgcg
ggcggaggcagcagcaggcgcttcgaggcagagaatgggccgacaccatctcctggccgc
agccccctggactcgcaggcgagcccaggactcgtgctgcacgccggggcggccaccagc
cagcgccgggagtccttcctgtaccgctcagacagcgactatgacatgtcacccaagacc
atgtcccggaactcatcggtcaccagcgaggcgcacgctgaagacctcatcgtaacacca
tttgctcaggtgctggccagcctccggagcgtccgtagcaacttctcactcctgaccaat
gtgcccgttcccagtaacaagcggtccccgctgggcggccccacccctgtctgcaaggcc
acgctgtcagaagaaacgtgtcagcagttggcccgggagactctggaggagctggactgg
tgtctggagcagctggagaccatgcagacctatcgctctgtcagcgagatggcctcgcac
aagttcaaaaggatgttgaaccgtgagctcacacacctgtcagaaatgagcaggtccgga
aaccaggtctcagagtacatttccacaacattcctggacaaacagaatgaagtggagatc
ccatcacccacgatgaaggaacgagaaaaacagcaagcgccgcgaccaagaccctcccag
ccgcccccgccccctgtaccacacttacagcccatgtcccaaatcacagggttgaaaaag
ttgatgcatagtaacagcctgaacaactctaacattccccgatttggggtgaagaccgat
caagaagagctcctggcccaagaactggagaacctgaacaagtggggcctgaacatcttt
tgcgtgtcggattacgctggaggccgctcactcacctgcatcatgtacatgatattccag
gagcgggacctgctgaagaaattccgcatccctgtggacacgatggtgacatacatgctg
acgctggaggatcactaccacgctgacgtggcctaccataacagcctgcacgcagctgac
gtgctgcagtccacccacgtactgctggccacgcctgcactagatgcagtgttcacggac
ctggagattctcgccgccctcttcgcggctgccatccacgatgtggatcaccctggggtc
tccaaccagttcctcatcaacaccaattcggagctggcgctcatgtacaacgatgagtcg
gtgctcgagaatcaccacctggccgtgggcttcaagctgctgcaggaggacaactgcgac
atcttccagaacctcagcaagcgccagcggcagagcctacgcaagatggtcatcgacatg
gtgctggccacggacatgtccaagcacatgaccctcctggctgacctgaagaccatggtg
gagaccaagaaagtgaccagctcaggggtcctcctgctagataactactccgaccgcatc
caggtcctccggaacatggtgcactgtgccgacctcagcaaccccaccaagccgctggag
ctgtaccgccagtggacagaccgcatcatggccgagttcttccagcagggtgaccgagag
cgcgagcgtggcatggaaatcagccccatgtgtgacaagcacactgcctccgtggagaag
tctcaggtgggttttattgactacattgtgcacccattgtgggagacctgggcggacctt
gtccacccagatgcccaggagatcttggacactttggaggacaaccgggactggtactac
agcgccatccggcagagcccatctccgccacccgaggaggagtcaagggggccaggccac
ccacccctgcctgacaagttccagtttgagctgacgctggaggaggaagaggaggaagaa
atatcaatggcccagataccgtgcacagcccaagaggcattgactgcgcagggattgtca
ggagtcgaggaagctctggatgcaaccatagcctgggaggcatccccggcccaggagtcg
ttggaagttatggcacaggaagcatccctggaggccgagctggaggcagtgtatttgaca
cagcaggcacagtccacaggcagtgcacctgtggctccggatgagttctcgtcccgggag
gaattcgtggttgctgtaagccacagcagcccctctgccctggctcttcaaagccccctt
ctccctgcttggaggaccctgtctgtttcagagcatgccccgggcctcccgggcctcccc
tccacggcggccgaggtggaggcccaacgagagcaccaggctgccaagagggcttgcagt
gcctgcgcagggacatttggggaggacacatccgcactcccagctcctggtggcgggggg
tcaggtggagaccctacctga

DBGET integrated database retrieval system