KEGG   Homo sapiens (human): 5142Help
Entry
5142              CDS       T01001                                 

Gene name
PDE4B, DPDE4, PDEIVB
Definition
(RefSeq) phosphodiesterase 4B (EC:3.1.4.53)
  KO
K13293  
cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cAMP signaling pathway
Morphine addiction
Drug target
Papaverine [DG:DG00043]: 
Drotaverine [DG:DG00044]: 
Moxaverine [DG:DG00045]: 
Bucladesine [DG:DG00230]: 
Trapidil: 
Flavoxate [DG:DG00477]: 
Apremilast: 
Caffeine [DG:DG00974]: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline [DG:DG01061]: 
Aminophylline [DG:DG01062]: 
Doxofylline: 
Ibudilast: 
Roflumilast: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5142 (PDE4B)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5142 (PDE4B)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5142 (PDE4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5142 (PDE4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31
AA seq 736 aa AA seqDB search
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcaggagtgtgatgacggtgatggctgatgataatgttaaagattatttt
gaatgtagcttgagtaaatcctacagttcttccagtaacacacttgggatcgacctctgg
agagggagaaggtgttgctcaggaaacttacagttaccaccactgtctcaaagacagagt
gaaagggcaaggactcctgagggagatggtatttccaggccgaccacactgcctttgaca
acgcttccaagcattgctattacaactgtaagccaggagtgctttgatgtggaaaatggc
ccttccccaggtcggagtccactggatccccaggccagctcttccgctgggctggtactt
cacgccacctttcctgggcacagccagcgcagagagtcatttctctacagatcagacagc
gactatgacttgtcaccaaaggcgatgtcgagaaactcttctcttccaagcgagcaacac
ggcgatgacttgattgtaactccttttgcccaggtccttgccagcttgcgaagtgtgaga
aacaacttcactatactgacaaaccttcatggtacatctaacaagaggtccccagctgct
agtcagcctcctgtctccagagtcaacccacaagaagaatcttatcaaaaattagcaatg
gaaacgctggaggaattagactggtgtttagaccagctagagaccatacagacctaccgg
tctgtcagtgagatggcttctaacaagttcaaaagaatgctgaaccgggagctgacacac
ctctcagagatgagccgatcagggaaccaggtgtctgaatacatttcaaatactttctta
gacaagcagaatgatgtggagatcccatctcctacccagaaagacagggagaaaaagaaa
aagcagcagctcatgacccagataagtggagtgaagaaattaatgcatagttcaagccta
aacaatacaagcatctcacgctttggagtcaacactgaaaatgaagatcacctggccaag
gagctggaagacctgaacaaatggggtcttaacatctttaatgtggctggatattctcac
aatagacccctaacatgcatcatgtatgctatattccaggaaagagacctcctaaagaca
ttcagaatctcatctgacacatttataacctacatgatgactttagaagaccattaccat
tctgacgtggcatatcacaacagcctgcacgctgctgatgtagcccagtcgacccatgtt
ctcctttctacaccagcattagacgctgtcttcacagatttggagatcctggctgccatt
tttgcagctgccatccatgacgttgatcatcctggagtctccaatcagtttctcatcaac
acaaattcagaacttgctttgatgtataatgatgaatctgtgttggaaaatcatcacctt
gctgtgggtttcaaactgctgcaagaagaacactgtgacatcttcatgaatctcaccaag
aagcagcgtcagacactcaggaagatggttattgacatggtgttagcaactgatatgtct
aaacatatgagcctgctggcagacctgaagacaatggtagaaacgaagaaagttacaagt
tcaggcgttcttctcctagacaactataccgatcgcattcaggtccttcgcaacatggta
cactgtgcagacctgagcaaccccaccaagtccttggaattgtatcggcaatggacagac
cgcatcatggaggaatttttccagcagggagacaaagagcgggagaggggaatggaaatt
agcccaatgtgtgataaacacacagcttctgtggaaaaatcccaggttggtttcatcgac
tacattgtccatccattgtgggagacatgggcagatttggtacagcctgatgctcaggac
attctcgataccttagaagataacaggaactggtatcagagcatgatacctcaaagtccc
tcaccaccactggacgagcagaacagggactgccagggtctgatggagaagtttcagttt
gaactgactctcgatgaggaagattctgaaggacctgagaaggagggagagggacacagc
tatttcagcagcacaaagacgctttgtgtgattgatccagaaaacagagattccctggga
gagactgacatagacattgcaacagaagacaagtcccccgtggatacataa

DBGET integrated database retrieval system