KEGG   Homo sapiens (human): 51422Help
Entry
51422             CDS       T01001                                 

Gene name
PRKAG2, AAKG, AAKG2, CMH6, H91620p, WPWS
Definition
protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Orthology
K07200  
5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Disease
H00069  
Glycogen storage diseases (GSD)
H00292  
Hypertrophic cardiomyopathy (HCM)
H01154  
Wolff-Parkinson-White (WPW) syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    51422 (PRKAG2)
   04152 AMPK signaling pathway
    51422 (PRKAG2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    51422 (PRKAG2)
   04920 Adipocytokine signaling pathway
    51422 (PRKAG2)
   04921 Oxytocin signaling pathway
    51422 (PRKAG2)
  Environmental adaptation
   04710 Circadian rhythm
    51422 (PRKAG2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    51422 (PRKAG2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51422 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q36.1
AA seq 525 aa AA seqDB search
MPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKT
VFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPS
TPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYA
PSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFD
TTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEH
KIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRI
LKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVD
ESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRI
VRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQKETETE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctggacggagacctggagggttccggaaagcattcctctcgaaaggtggac
agccccttcggcccgggcagcccctccaaagggttcttctccagaggcccccagccccgg
ccctccagccccatgtctgcacctgtgaggcccaagaccagccccggctctcccaaaacc
gtgttcccgttctcctaccaggagtccccgccacgctcccctcgacgcatgagcttcagt
gggatcttccgctcctcctccaaagagtcttcccccaactccaaccctgctacctcgccc
gggggcatcaggtttttctcccgctccagaaaaacctccggcctctcctcctctccgtca
acacccacccaagtgaccaagcagcacacgtttcccctggaatcctataagcacgagcct
gaacggttagagaatcgcatctatgcctcgtcttcccccccggacacagggcagaggttc
tgcccgtcttccttccagagcccgaccaggcctccactggcatcaccgacacactatgct
ccctccaaagccgcggcgctggcggcggccctgggacccgcggaagccggcatgctggag
aagctggagttcgaggacgaagcagtagaagactcagaaagtggtgtttacatgcgattc
atgaggtcacacaagtgttatgacatcgttccaaccagttcaaagcttgttgtctttgat
actacattacaagttaaaaaggccttctttgctttggtagccaacggtgtccgagcagcg
ccactgtgggagagtaaaaaacaaagttttgtaggaatgctaacaattacagatttcata
aatatactacatagatactataaatcacctatggtacagatttatgaattagaggaacat
aaaattgaaacatggagggagctttatttacaagaaacatttaagcctttagtgaatata
tctccagatgcaagcctcttcgatgctgtatactccttgatcaaaaataaaatccacaga
ttgcccgttattgaccctatcagtgggaatgcactttatatacttacccacaaaagaatc
ctcaagttcctccagctttttatgtctgatatgccaaagcctgccttcatgaagcagaac
ctggatgagcttggaataggaacgtaccacaacattgccttcatacatccagacactccc
atcatcaaagccttgaacatatttgtggaaagacgaatatcagctctgcctgttgtggat
gagtcaggaaaagttgtagatatttattccaaatttgatgtaattaatcttgctgctgag
aaaacatacaataacctagatatcacggtgacccaggcccttcagcaccgttcacagtat
tttgaaggtgttgtgaagtgcaataagctggaaatactggagaccatcgtggacagaata
gtaagagctgaggtccatcggctggtggtggtaaatgaagcagatagtattgtgggtatt
atttccctgtcggacattctgcaagccctgatcctcacaccagcaggtgccaaacaaaag
gagacagaaacggagtga

DBGET integrated database retrieval system