KEGG   Homo sapiens (human): 5144Help
Entry
5144              CDS       T01001                                 

Gene name
PDE4D, ACRDYS2, DPDE3, HSPDE4D, PDE43, PDE4DN2, STRK1
Definition
(RefSeq) phosphodiesterase 4D (EC:3.1.4.53)
  KO
K13293  
cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cAMP signaling pathway
Morphine addiction
Drug target
Aminophylline (DG01062): 
Apremilast: 
Arofylline: 
Bucladesine (DG00230): 
Caffeine (DG00974): 
Catramilast: 
Choline theophyllinate: 
Cilomilast: 
Cipamfylline: 
Doxofylline: 
Drotaverine (DG00044): 
Filaminast: 
Flavoxate (DG00477): 
Ibudilast: 
Moxaverine (DG00045): 
Papaverine (DG00043): 
Piclamilast: 
Propentofylline: 
Proxyphylline: 
Roflumilast: 
Rolipram: 
Theophylline (DG01061): 
Tibenelast sodium: 
Tofimilast: 
Trapidil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5144 (PDE4D)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5144 (PDE4D)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5144 (PDE4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5144 (PDE4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12
AA seq 809 aa AA seqDB search
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagggcagcagcgcgccggcccgggcgggcagcggagagggcagcgacagc
gccggcggggccacgctcaaagcccccaagcatctctggaggcacgagcagcaccaccag
tacccgctccggcagccccagttccgcctcctgcatccccatcaccacctgcccccgccg
ccgccaccctcgccccagccccagccccagtgtccgctacagccgccgccgccgcccccc
ctgccgccgcccccgccgccgcccggggctgcccgcggccgctacgcctcgagcggggcc
accggccgcgtccggcatcgcggctactcggacaccgagcgctacctgtactgtcgcgcc
atggaccgcacctcctacgcggtggagaccggccaccggcccggcctgaagaaatccagg
atgtcctggccctcctcgttccagggactcaggcgttttgatgtggacaatggcacatct
gcgggacggagtcccttggatcccatgaccagcccaggatccgggctaattctccaagca
aattttgtccacagtcaacgacgggagtccttcctgtatcgatccgacagcgattatgac
ctctctccaaagtctatgtcccggaactcctccattgccagtgatatacacggagatgac
ttgattgtgactccatttgctcaggtcttggccagtctgcgaactgtacgaaacaacttt
gctgcattaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaa
ccatccatcaacaaagccaccataacagaggaggcctaccagaaactggccagcgagacc
ctggaggagctggactggtgtctggaccagctagagaccctacagaccaggcactccgtc
agtgagatggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctct
gaaatgagtcggtctggaaatcaagtgtcagagtttatatcaaacacattcttagataag
caacatgaagtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaagacca
atgtctcagatcagtggagtcaagaaattgatgcacagctctagtctgactaattcaagt
atcccaaggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagat
gtgaacaaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcccttg
actgttatcatgcacaccatttttcaggaacgggatttattaaaaacatttaaaattcca
gtagatactttaattacatatcttatgactctcgaagaccattaccatgctgatgtggcc
tatcacaacaatatccatgctgcagatgttgtccagtctactcatgtgctattatctaca
cctgctttggaggctgtgtttacagatttggagattcttgcagcaatttttgccagtgca
atacatgatgtagatcatcctggtgtgtccaatcaatttctgatcaatacaaactctgaa
cttgccttgatgtacaatgattcctcagtcttagagaaccatcatttggctgtgggcttt
aaattgcttcaggaagaaaactgtgacattttccagaatttgaccaaaaaacaaagacaa
tctttaaggaaaatggtcattgacatcgtacttgcaacagatatgtcaaaacacatgaat
ctactggctgatttgaagactatggttgaaactaagaaagtgacaagctctggagttctt
cttcttgataattattccgataggattcaggttcttcagaatatggtgcactgtgcagat
ctgagcaacccaacaaagcctctccagctgtaccgccagtggacggaccggataatggag
gagttcttccgccaaggagaccgagagagggaacgtggcatggagataagccccatgtgt
gacaagcacaatgcttccgtggaaaaatcacaggtgggcttcatagactatattgttcat
cccctctgggagacatgggcagacctcgtccaccctgacgcccaggatattttggacact
ttggaggacaatcgtgaatggtaccagagcacaatccctcagagcccctctcctgcacct
gatgacccagaggagggccggcagggtcaaactgagaaattccagtttgaactaacttta
gaggaagatggtgagtcagacacggaaaaggacagtggcagtcaagtggaagaagacact
agctgcagtgactccaagactctttgtactcaagactcagagtctactgaaattcccctt
gatgaacaggttgaagaggaggcagtaggggaagaagaggaaagccagcctgaagcctgt
gtcatagatgatcgttctcctgacacgtaa

DBGET integrated database retrieval system