KEGG   Homo sapiens (human): 515Help
Entry
515               CDS       T01001                                 

Gene name
ATP5F1, PIG47
Definition
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
Orthology
K02127  
F-type H+-transporting ATPase subunit b
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    515 (ATP5F1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    515 (ATP5F1)
   05012 Parkinson's disease
    515 (ATP5F1)
   05016 Huntington's disease
    515 (ATP5F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p13.2
AA seq 256 aa AA seqDB search
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIP
EEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFV
ADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEV
TYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCI
ADLKLLAKKAQAQPVM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggtggtactttccgccgccgccacagcggccccctctctgaagaatgca
gccttcctaggtccaggggtattgcaggcaacaaggacctttcatacagggcagccacac
cttgtccctgtaccacctcttcctgaatacggaggaaaagttcgttatggactgatccct
gaggaattcttccagtttctttatcctaaaactggtgtaacaggaccctatgtactcgga
actgggcttatcttgtacgctttatccaaagaaatatatgtgattagcgcagagaccttc
actgccctatcagtactaggtgtaatggtctatggaattaaaaaatatggtccctttgtt
gcagactttgctgataaactcaatgagcaaaaacttgcccaactagaagaggcgaagcag
gcttccatccaacacatccagaatgcaattgatacggagaagtcacaacaggcactggtt
cagaagcgccattacctttttgatgtgcaaaggaataacattgctatggctttggaagtt
acttaccgggaacgactgtatagagtatataaggaagtaaagaatcgcctggactatcat
atatctgtgcagaacatgatgcgtcgaaaggaacaagaacacatgataaattgggtggag
aagcacgtggtgcaaagcatctccacacagcaggaaaaggagacaattgccaagtgcatt
gcggacctaaagctgctggcaaagaaggctcaagcacagccagttatgtaa

DBGET integrated database retrieval system