KEGG   Homo sapiens (human): 515Help
Entry
515               CDS       T01001                                 

Gene name
ATP5F1, PIG47
Definition
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
Orthology
K02127  
F-type H+-transporting ATPase subunit b
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p13.2
AA seq 256 aa AA seqDB search
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIP
EEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFV
ADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEV
TYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCI
ADLKLLAKKAQAQPVM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggtggtactttccgccgccgccacagcggccccctctctgaagaatgca
gccttcctaggtccaggggtattgcaggcaacaaggacctttcatacagggcagccacac
cttgtccctgtaccacctcttcctgaatacggaggaaaagttcgttatggactgatccct
gaggaattcttccagtttctttatcctaaaactggtgtaacaggaccctatgtactcgga
actgggcttatcttgtacgctttatccaaagaaatatatgtgattagcgcagagaccttc
actgccctatcagtactaggtgtaatggtctatggaattaaaaaatatggtccctttgtt
gcagactttgctgataaactcaatgagcaaaaacttgcccaactagaagaggcgaagcag
gcttccatccaacacatccagaatgcaattgatacggagaagtcacaacaggcactggtt
cagaagcgccattacctttttgatgtgcaaaggaataacattgctatggctttggaagtt
acttaccgggaacgactgtatagagtatataaggaagtaaagaatcgcctggactatcat
atatctgtgcagaacatgatgcgtcgaaaggaacaagaacacatgataaattgggtggag
aagcacgtggtgcaaagcatctccacacagcaggaaaaggagacaattgccaagtgcatt
gcggacctaaagctgctggcaaagaaggctcaagcacagccagttatgtaa

DBGET integrated database retrieval system