KEGG   Homo sapiens (human): 5151Help
Entry
5151              CDS       T01001                                 

Gene name
PDE8A, HsT19550
Definition
(RefSeq) phosphodiesterase 8A
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing's syndrome
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Papaverine (DG00043): D02218 D07425 D07439
Propentofylline: D01630
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5151 (PDE8A)
 Organismal Systems
  Endocrine system
   04927 Cortisol synthesis and secretion
    5151 (PDE8A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5151 (PDE8A)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5151 (PDE8A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5151 (PDE8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PAS PAS_9 PAS_4 PAS_3 PDE8 PAS_8
Motif
Other DBs
NCBI-GeneID: 5151
NCBI-ProteinID: NP_002596
OMIM: 602972
HGNC: 8793
Ensembl: ENSG00000073417
Vega: OTTHUMG00000148670
Pharos: O60658(Tclin)
UniProt: O60658
Structure
PDB: 

Jmol
Position
15q25.3
AA seq 829 aa AA seqDB search
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgccccgagcatccacatttccgagcgcctggtggccgaggacgcgcctagc
cccgcggcaccgccgctgtcgtccggcgggccgcgcctcccgcagggccagaagacggcc
gccttgccccggacccgcggcgccggcctcttggagtcggagcttcgcgacggcagcggc
aagaaggtagcagtagctgatgtgcagtttggccccatgagatttcatcaagatcaactt
caggtacttttagtgtttaccaaagaagataaccaatgtaatggattctgcagggcatgt
gaaaaagcagggtttaagtgtacagttaccaaggaggctcaggctgtccttgcctgtttc
ctggacaaacatcatgacattatcatcatagaccacagaaatcctcgacagctggatgca
gaggcactgtgcaggtctatcagatcatcaaaactctcagaaaacacagttattgttggt
gtagtacgcagggtggatagagaagagttgtccgtaatgcctttcatttctgctggattt
acaaggaggtatgtagaaaaccccaacatcatggcctgctacaatgaactgctccagctg
gagtttggagaggtgcgatcacaactgaaactcagggcttgtaactcagtattcactgca
ttagaaaacagtgaagatgcaattgaaattacaagcgaagaccgttttatacagtatgca
aatcctgcatttgaaacaacaatgggctatcagtcaggtgaattaatagggaaggagtta
ggagaagtgcctataaatgaaaaaaaggctgacttgctcgatactataaattcatgcatc
aggataggcaaggagtggcaaggaatttactatgccaaaaagaaaaacggagataatata
caacaaaatgtgaagataatacctgtcattggacagggaggaaaaattagacactatgtg
tccattatcagagtgtgcaatggcaacaataaggctgagaaaatatccgaatgtgttcag
tctgacactcatacagataatcagacaggcaaacataaagacaggagaaaaggctcacta
gacgtcaaagctgttgcctcccgtgcaactgaagtttccagccagagacgacactcttcc
atggcccggatacattccatgacaattgaggcgcccatcaccaaggtaatcaatattatc
aatgctgcccaggaaagtagtcccatgcctgtgacagaagccctagaccgtgtgctggaa
attctaagaaccactgagttatattcaccacagtttggtgctaaagatgatgatccccat
gccaatgaccttgttgggggcttaatgtctgatggtttgcgaagactatcagggaatgaa
tatgttctttcaacaaaaaacactcaaatggtttcaagcaatataatcactcccatctcc
cttgatgatgtcccaccacggatagctcgggccatggaaaatgaggaatactgggacttt
gatatttttgaactggaggctgccacccacaataggcctttgatttatcttggtctcaaa
atgtttgctcgctttggaatctgtgaattcttacactgctccgagtcaacgctaagatca
tggttacaaattatcgaagccaattatcattcctccaatccctaccacaattctacacat
tctgctgatgtgcttcatgccactgcctattttctctccaaggagaggataaaggaaact
ttagatccaattgatgaggtcgctgcactcatcgcagccaccattcatgatgtggatcac
cctgggagaaccaactccttcctgtgtaatgctggaagtgagctggccattttgtacaat
gacactgctgtgctggagagccaccatgcggccttggccttccagctgaccactggagat
gataaatgcaatatatttaaaaacatggagaggaatgattatcggacactgcgccagggg
attatcgacatggtcttagccacagaaatgacaaagcactttgagcatgtcaacaaattt
gtcaacagcatcaacaaacccttggcaacactagaagaaaatggggaaactgataaaaac
caggaagtgataaacactatgcttaggactccagagaaccggaccctaatcaaacgaatg
ctgattaaatgtgctgatgtgtccaatccctgccgacccctgcagtactgcatcgagtgg
gctgcacgcatttcggaagaatatttttctcagactgatgaagagaagcagcagggctta
cctgtggtgatgccagtgtttgacagaaatacctgcagcatccccaaatcccaaatctct
ttcattgattacttcatcacagacatgtttgatgcttgggatgcctttgtagacctgcct
gatttaatgcagcatcttgacaacaactttaaatactggaaaggactggacgaaatgaag
ctgcggaacctccgaccacctcctgaatag

DBGET integrated database retrieval system