KEGG   Homo sapiens (human): 5153Help
Entry
5153              CDS       T01001                                 

Gene name
PDE1B, PDE1B1, PDES1B
Definition
(RefSeq) phosphodiesterase 1B, calmodulin-dependent (EC:3.1.4.17)
  KO
K13755  
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Calcium signaling pathway
Renin secretion
Morphine addiction
Drug target
Papaverine: 
Moxaverine: 
Bucladesine: 
Trapidil: 
Flavoxate: 
Caffeine: 
Propentofylline: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5153 (PDE1B)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5153 (PDE1B)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    5153 (PDE1B)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5153 (PDE1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5153 (PDE1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 536 aa AA seqDB search
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccggagatgctggaggagtcggattgcccgtcaccc
ctggagctgaagtcagcccccagcaagaagatgtggattaagcttcggtctctgctgcgc
tacatggtgaagcagttggagaatggggagataaacattgaggagctgaagaaaaatctg
gagtacacagcttctctgctggaagccgtctacatagatgagacacggcaaatcttggac
acggaggacgagctgcaggagctgcggtcagatgccgtgccttcggaggtgcgggactgg
ctggcctccaccttcacccagcaggcccgggccaaaggccgccgagcagaggagaagccc
aagttccgaagcattgtgcacgctgtgcaggctgggatcttcgtggaacggatgttccgg
agaacatacacctctgtgggccccacttactctactgcggttctcaactgtctcaagaac
ctggatctctggtgctttgatgtcttttccttgaaccaggcagcagatgaccatgccctg
aggaccattgtttttgagttgctgactcggcataacctcatcagccgcttcaagattccc
actgtgtttttgatgagtttcctggatgccttggagacaggctatgggaagtacaagaat
ccttaccacaaccagatccacgcagccgatgttacccagacagtccattgcttcttgctc
cgcacagggatggtgcactgcctgtcggagattgagctcctggccatcatctttgctgca
gctatccatgattatgagcacacgggcactaccaacagcttccacatccagaccaagtca
gaatgtgccatcgtgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtt
ttccgattgatgcaggatgatgagatgaacattttcatcaacctcaccaaggatgagttt
gtagaactccgagccctggtcattgagatggtgttggccacagacatgtcctgccatttc
cagcaagtgaagaccatgaagacagccttgcaacagctggagaggattgacaagcccaag
gccctgtctctactgctccatgctgctgacatcagccacccaaccaagcagtggttggtc
cacagccgttggaccaaggccctcatggaggaattcttccgtcagggtgacaaggaggca
gagttgggcctgcccttttctccactctgtgaccgcacttccactctagtggcacagtct
cagatagggttcatcgacttcattgtggagcccacattctctgtgctgactgacgtggca
gagaagagtgttcagcccctggcggatgaggactccaagtctaaaaaccagcccagcttt
cagtggcgccagccctctctggatgtggaagtgggagaccccaaccctgatgtggtcagc
tttcgttccacctgggtcaagcgcattcaggagaataagcagaaatggaaggaacgggca
gcaagtggcatcaccaaccagatgtccattgacgagctgtccccctgtgaagaagaggcc
cccccatcccctgccgaagatgaacacaaccagaatgggaatctggattag

DBGET integrated database retrieval system